Details for Chinese cabbage Locus Brara.E02635

Position : A05 ( 5`- 23120662 .. 23121968 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02635

Protein [Map View]
MNKSPRIDIPSSSSPASASSADGEFNEDDIFSIDVTHTPPSSSPSQHPPARQLQRSKSGLKNVEASGILAALPEPSGNSY
LNHVFHHKPAASSSPSSSSARTIPSAPKPPQERLPYTASFIGGGKFPQSAPVQVPLASSAMMNRHKKEFKLTDVVDEDEE
EEEGEMLPPHEIVARSLAQSSLLSSSVLEGAGRTLKGRDLRQVRNAVFRRTGFID*

DNA
ATGAACAAAAGTCCTCGCATCGATATCCCTTCATCGTCTTCTCCTGCTTCAGCTTCTTCTGCAGATGGTGAGTTCAATGA
AGACGACATCTTCTCGATAGACGTAACTCACACTCCTCCGTCTTCTTCTCCTTCTCAACACCCGCCTGCTCGCCAGCTTC
AACGGAGCAAAAGCGGTTTGAAAAACGTGGAAGCTTCTGGTATCCTCGCCGCTCTTCCCGAGCCTTCTGGTAACAGCTAC
CTCAACCACGTCTTTCACCATAAGCCTGCAGCTTCTTCCTCGCCTTCTTCGTCTTCGGCTCGAACCATTCCCTCAGCTCC
TAAACCGCCTCAAGAGAGGCTTCCGTATACAGCTTCTTTTATAGGTGGAGGGAAGTTTCCTCAGTCAGCTCCGGTTCAAG
TGCCGTTAGCATCTTCGGCGATGATGAATCGTCATAAGAAGGAGTTCAAGCTGACTGATGTGGTGGATGAGGATGAGGAG
GAAGAAGAAGGTGAAATGCTTCCTCCACATGAGATTGTAGCTCGGTCTTTGGCGCAGTCTTCTTTACTGTCTAGCTCGGT
GCTTGAAGGAGCTGGAAGAACACTTAAAGGGAGAGATCTCAGACAGGTAAGGAATGCTGTTTTCAGAAGAACCGGTTTCA
TAGATTGA