Details for Chinese cabbage Locus Brara.E02633

Position : A05 ( 5`- 23110002 .. 23112052 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02633

Protein [Map View]
MSSDLKRKQKKKNPKPVQINPNWSLLQQKLKSDSNNSGNRKSSNNDDSDDPRSILGKRKERPDSEVDVPKISPLAPVNDD
TSLTDEVAMDCEMVGVSQGTKSALGRVTLVNKWGNVLYDEFVRPVERVVDFRTHISGIRPRDLRKAKDFRVAQTKVAELI
KGKILVGHALHNDLKVLLLTHPKKDIRDTAEYQPFLKDKTRKSLKHLASEFLGADIQNGEHCPIDDARAAMLLYQKNRRE
WERNVKDQTRMRLKQKKRKPKKKVKEANHTSTV*

DNA
ATGAGTTCTGATCTGAAGAGAAAGCAGAAGAAGAAAAACCCTAAACCCGTTCAGATAAACCCTAATTGGTCACTCCTCCA
ACAAAAGCTGAAATCTGATTCGAATAACTCGGGCAATCGAAAATCTTCAAACAATGACGACTCAGATGATCCCAGGTCCA
TATTAGGGAAGCGGAAAGAGAGACCTGATTCGGAGGTGGATGTTCCTAAGATTAGTCCTTTAGCACCTGTCAATGACGAT
ACCAGTTTGACAGATGAAGTGGCTATGGACTGTGAAATGGTTGGTGTCAGTCAAGGAACCAAAAGCGCCCTTGGACGTGT
TACCTTGGTAAATAAGTGGGGGAATGTTCTATACGATGAGTTTGTGCGTCCTGTGGAACGTGTTGTTGACTTTCGAACGC
ATATTAGTGGGATTCGACCTAGAGACTTAAGAAAGGCCAAAGATTTCCGAGTGGCTCAGACCAAAGTAGCGGAGTTGATC
AAGGGAAAGATTCTCGTGGGACATGCCTTGCATAACGATCTCAAGGTTTTACTGTTAACTCACCCGAAAAAGGACATAAG
GGACACAGCAGAGTATCAGCCTTTTCTCAAGGACAAAACAAGAAAGTCACTGAAACATCTTGCATCTGAGTTTCTAGGAG
CCGACATCCAAAACGGAGAGCACTGTCCTATTGATGATGCACGAGCCGCAATGCTGCTTTACCAGAAGAACAGAAGGGAG
TGGGAGAGAAATGTGAAAGACCAGACACGGATGAGGCTGAAACAAAAGAAGCGTAAGCCTAAGAAGAAAGTAAAGGAAGC
TAATCACACCTCAACTGTTTGA