Details for Chinese cabbage Locus Brara.E02631

Position : A05 ( 5`- 23096656 .. 23098593 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02631

Protein [Map View]
MAETERPHRSSSINSSSNARNASSSSSTDLFICFTSRFSSSSSMRLSSLSPARSACLTTSLSRRLRTSGSIKNASAGVLN
SPMFGNSGGRKRSGSGYENGNNNNNIEPSSPKVTCIGQVRVKTRKHVKKKMRARSRRRGETSSFRRSSSDQNDRGGCRFD
ASENRWVHFPVTICESLRSFGSELNCFSSPCRSSCTGGSDGRRRGESSGGGGGGSSCFTRWFVAVEETGGKRREIELVVG
GGEDEEAAEDGRRRSRRRHVFEGLDLSEIEMKTEERRGREDVGMINLCSPPKNALLLMRCRSDPVKVAALANRVRERQMS
LDEGVYGGGEEEEDEERRRFELDLEDKKRIELCEKWISGETIVEREVVSITEPEAPKEEDSEEEASKVHEEEIEAMIIKH
IEDDLRNAIEEEEEEEETAEMEEEERKEEEEVAASVTVTPNVERSNQGNREPDPSPEVIMRGETMEKEKTTPYKVLPDCL
LLMMCEPKLSMEVSKETWVCSTDFVRCQPGRPPAKKITEATGEHHHHHHHQQPKKRIVTGVDSNASSRRRSVDKRPVHHS
LLQPPRSSCSYPAAPPLLTTAASVREQKVGGGNKAYEPPVLPRCKSEPRKSASKLAPEACFWKNRKLEPHPQASVGVGGG
AGVGF*

DNA
ATGGCGGAAACTGAGAGACCCCACCGTTCTTCAAGTATTAACAGTAGCAGCAACGCAAGAAACGCTTCTTCATCTTCTTC
AACTGATTTATTCATTTGTTTCACATCTCGCTTCTCTTCTTCCTCCTCCATGCGCCTCTCTTCCCTCAGCCCAGCTCGCT
CCGCCTGCCTCACCACTTCTCTCAGCCGTCGTCTTCGCACGAGCGGCAGCATAAAGAACGCTTCGGCCGGAGTTCTAAAC
TCTCCGATGTTCGGTAATAGCGGCGGACGTAAGAGATCTGGATCCGGCTACGAAAATGGTAATAATAATAACAACATAGA
GCCGTCGTCTCCGAAGGTGACGTGTATCGGTCAAGTGAGGGTGAAGACGAGGAAGCACGTGAAGAAGAAGATGAGAGCGA
GATCTAGGAGGAGAGGCGAGACGAGCAGCTTCAGGAGATCGTCTTCTGACCAAAACGACAGAGGAGGGTGTCGTTTCGAC
GCGAGCGAGAACCGTTGGGTTCATTTCCCCGTGACTATCTGCGAGTCGTTGAGATCGTTCGGCTCCGAGCTTAACTGCTT
CTCCTCGCCGTGTAGATCTTCTTGCACGGGGGGTAGCGACGGGCGGCGGCGAGGTGAGAGTAGCGGCGGAGGAGGAGGAG
GAAGCTCGTGCTTCACGCGGTGGTTTGTGGCGGTGGAGGAGACGGGAGGGAAGAGGAGGGAGATCGAGCTTGTGGTTGGA
GGAGGGGAAGACGAGGAGGCGGCGGAGGATGGGAGGAGGAGGAGTCGCCGGAGGCATGTTTTCGAGGGGCTTGATTTGAG
CGAGATTGAGATGAAGACGGAGGAGAGGAGAGGGAGGGAGGATGTTGGGATGATTAATCTCTGTTCTCCGCCGAAGAACG
CTTTGTTGTTGATGAGGTGTAGATCTGATCCGGTTAAGGTGGCTGCGTTGGCGAACCGGGTTCGGGAGAGGCAGATGTCG
CTTGATGAGGGAGTGTATGGTGGAGGAGAGGAGGAGGAAGATGAGGAGAGGAGGAGGTTTGAGCTTGACTTGGAAGACAA
GAAGCGGATCGAGTTGTGTGAGAAATGGATTTCTGGAGAGACTATTGTCGAGAGAGAAGTAGTTTCTATTACAGAACCAG
AAGCTCCCAAAGAGGAAGATTCAGAAGAAGAAGCTTCGAAGGTACATGAGGAAGAGATTGAAGCTATGATCATCAAACAC
ATTGAAGACGATCTCAGAAACGCTATAGAGGAAGAAGAAGAAGAGGAGGAAACGGCTGAGATGGAAGAAGAAGAAAGGAA
AGAGGAGGAGGAGGTAGCTGCCTCTGTCACTGTGACTCCAAACGTGGAAAGATCCAACCAAGGAAACAGAGAACCTGACC
CGAGTCCGGAAGTGATAATGAGAGGAGAAACTATGGAGAAAGAGAAGACGACGCCGTATAAGGTGTTACCGGATTGTCTA
CTGCTAATGATGTGCGAGCCGAAGCTATCGATGGAAGTCTCCAAGGAGACTTGGGTCTGCTCCACGGACTTCGTGAGATG
TCAACCGGGAAGACCTCCGGCGAAGAAGATAACCGAAGCCACCGGAGAACATCATCACCATCATCATCATCAACAACCCA
AGAAACGAATCGTCACCGGCGTTGACTCCAACGCATCTTCTCGCCGGCGTTCAGTCGATAAACGACCTGTTCACCATTCG
CTGTTACAGCCGCCGAGGTCATCCTGCTCGTACCCAGCTGCTCCGCCGTTGTTAACGACGGCTGCGTCGGTTAGAGAGCA
GAAGGTAGGAGGAGGTAACAAGGCGTACGAGCCGCCGGTGCTGCCGCGTTGCAAGTCGGAGCCGAGGAAGTCGGCTTCGA
AGCTTGCGCCGGAAGCTTGTTTCTGGAAAAATCGGAAGCTCGAGCCGCATCCTCAAGCTTCTGTCGGAGTCGGCGGCGGC
GCCGGAGTAGGGTTCTAG