Details for Chinese cabbage Locus Brara.E02629

Position : A05 ( 5`- 23092200 .. 23093540 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02629

Protein [Map View]
MDPTLNDHQEFEQVEAIDDLLEDFWFFDNLLGRRSTILRYCHSDPYPFSPSSPSSSSTHPKPEVLNTGDSVLEKKLLEAL
TVGDSVPPPCTVKEEGGGEPEKMKKMRRQFSEKIRVQERTTYLQKKEPVVRREKGIRESTKNNRTGRSSCNNKNVPMGGS
LQRTQTLPTYIGREGDRNEFADQESDDSRMGYLIREAIASSSSGFTTPTKQNTPKMSSIPRHRPPRNSRSDEAIQEMAVK
SQGSKTLRKTFSSIDTKEVMTLKELDITEPEKKQEKDDEDQRRAVKSRSAVVVGQPIPVWVPNESRRDMKAQIKFWARTV
ASNVRQEC*

DNA
ATGGATCCTACTTTGAATGATCATCAAGAGTTTGAACAAGTCGAGGCTATTGATGATCTTCTCGAAGATTTCTGGTTCTT
TGATAACTTACTTGGCAGAAGGTCAACAATCTTGAGGTACTGTCATTCAGATCCTTACCCTTTTTCTCCTTCTTCTCCCT
CCTCCTCTTCTACTCATCCCAAACCAGAAGTCTTGAACACTGGAGATTCCGTTCTGGAGAAGAAGCTTCTAGAAGCTCTC
ACAGTGGGAGATTCTGTCCCACCACCGTGTACAGTGAAGGAAGAAGGTGGAGGTGAGCCTGAGAAGATGAAAAAGATGAG
AAGGCAGTTCTCTGAGAAGATTAGGGTTCAAGAAAGAACAACTTACTTGCAGAAGAAGGAACCTGTGGTTCGTCGAGAGA
AGGGGATTAGAGAAAGTACTAAAAATAACAGAACTGGTAGAAGTAGTTGTAATAACAAGAATGTTCCGATGGGAGGGAGT
TTGCAGAGAACTCAGACATTACCTACTTACATAGGAAGAGAAGGTGATAGAAACGAGTTTGCCGATCAAGAGAGCGACGA
TTCGAGAATGGGATACTTGATCCGTGAAGCCATCGCAAGCTCTTCTTCCGGGTTTACTACTCCAACGAAACAGAATACTC
CAAAGATGTCAAGCATTCCAAGGCATAGACCACCGAGAAACTCGAGATCAGATGAAGCTATTCAAGAAATGGCTGTCAAG
TCACAAGGAAGTAAAACGCTGCGTAAGACGTTTAGCAGCATCGATACGAAAGAGGTTATGACGTTGAAGGAGTTGGACAT
TACTGAACCGGAGAAGAAACAAGAAAAAGATGATGAAGATCAGAGGAGGGCCGTGAAAAGCCGGTCAGCTGTGGTTGTGG
GACAGCCGATACCGGTTTGGGTTCCAAATGAGTCGAGAAGAGACATGAAAGCTCAAATCAAGTTTTGGGCTCGAACCGTG
GCTAGTAATGTTCGACAAGAATGTTAA