Details for Chinese cabbage Locus Brara.E02628

Position : A05 ( 5`- 23089421 .. 23091310 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02628

Protein [Map View]
MASALSAFRVSISRISSFRARQFSYPATSGLAHTKRIICSSSHSPSPSDTSSSSVSLMETNKNTRWRPMCLYYTHGKCTK
MDDPAHLEVFNHDCSKELPVTAADLEGKKPQEFDFFLVLDLEGKVEILEFPVLIVDARTMQVVDLFHRFVRPTKMSEQAI
NKYIEGKYGEVGVDRVWHDTAIPFKQVVEEFEGWLAEHGLWGKETDGALNDAAFVTCGNWDIKTKIPEQCVVANINLPQY
FMEWINLKDVYLNFYGREARGMVSMMKQCGIRLMGSHHLGIDDTKNITRVVQRMLADGAVFKITARRSKSNMRNVEFLFK
NRIK*

DNA
ATGGCGTCTGCTCTCTCTGCATTTAGGGTTTCAATCTCTAGAATTAGTTCTTTCCGTGCTAGGCAATTCTCTTATCCCGC
GACTTCCGGTTTAGCCCATACCAAGCGAATCATTTGCAGCTCTTCGCATTCTCCATCTCCGTCTGATACTTCGTCTTCAT
CTGTTTCGTTGATGGAAACAAATAAAAACACGAGGTGGAGACCCATGTGCTTGTATTACACTCACGGGAAGTGCACAAAG
ATGGATGATCCTGCCCATTTGGAAGTTTTTAATCATGATTGTTCCAAGGAGCTTCCAGTGACCGCTGCTGATCTCGAGGG
GAAGAAGCCACAGGAGTTCGACTTTTTCTTGGTTCTTGACTTGGAAGGAAAAGTTGAGATTCTAGAGTTTCCTGTTTTGA
TCGTTGACGCCAGAACCATGCAAGTCGTAGACTTGTTCCACAGGTTTGTGAGACCCACCAAAATGAGCGAGCAAGCAATT
AACAAGTACATCGAAGGCAAGTATGGAGAAGTTGGTGTTGATCGAGTGTGGCATGACACAGCTATTCCATTTAAGCAAGT
TGTTGAGGAGTTTGAAGGCTGGTTAGCTGAGCATGGCTTGTGGGGTAAAGAAACAGACGGGGCTCTGAATGATGCAGCTT
TTGTAACCTGTGGAAACTGGGATATAAAGACAAAGATTCCCGAGCAATGCGTAGTGGCAAATATCAATCTTCCGCAATAT
TTCATGGAGTGGATTAATCTCAAAGACGTCTACTTGAACTTCTACGGACGTGAGGCCAGAGGAATGGTGTCAATGATGAA
GCAATGTGGAATAAGGCTCATGGGAAGCCACCATCTAGGCATTGATGACACAAAGAACATCACGAGAGTGGTGCAACGGA
TGCTCGCTGACGGTGCAGTGTTCAAGATCACAGCACGAAGGAGCAAGTCTAATATGAGAAACGTCGAGTTTTTGTTCAAG
AACCGGATCAAGTAA