Details for Chinese cabbage Locus Brara.E02627

Position : A05 ( 5`- 23087524 .. 23089183 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02627

Protein [Map View]
MASASSSGGVAGRLRNASLVLVGDNDSTISDIRKAVTLMKNIAVQLEKDNQTEKVKDLENSVAELLDLYGDCAHRSSAIQ
SVANGYQPGEQLTDFKKLLDDEFTKLKATTPSVPENHHLMRQFREAVWNVHHAGEPMPGEDEEDIVMTSTQCPFLNVKCP
VSGKPLTELTDPVRSIDCKHVYDKASIMHYIATNPNAKCPIAGCRGKLKSNKVVCDPMLKFEIEELRTMNKQSNRDEVIE
DFTNADDED*

DNA
ATGGCGTCGGCGTCCTCTTCAGGCGGAGTCGCCGGAAGGCTTCGAAACGCATCGTTGGTTCTCGTAGGCGATAACGATTC
CACAATCTCTGACATACGTAAAGCTGTGACTTTGATGAAGAACATTGCCGTTCAGCTGGAGAAAGATAACCAAACTGAGA
AGGTTAAAGACCTTGAAAACTCTGTGGCTGAGCTGTTGGATTTGTATGGTGATTGTGCTCATCGTTCCTCAGCTATTCAA
TCTGTTGCAAATGGGTACCAGCCTGGAGAACAGTTAACTGACTTTAAAAAGTTGCTTGACGATGAGTTCACAAAGCTCAA
GGCTACAACTCCTTCAGTGCCAGAAAATCATCATTTGATGCGTCAGTTCCGGGAAGCTGTTTGGAACGTTCATCATGCAG
GTGAACCAATGCCTGGCGAAGACGAAGAAGACATTGTCATGACCAGTACTCAGTGCCCTTTCCTAAACGTGAAATGCCCT
GTGAGCGGGAAGCCTCTCACTGAACTAACAGATCCAGTTCGCAGTATTGATTGCAAGCACGTGTACGACAAAGCTTCAAT
CATGCATTACATAGCCACCAATCCCAATGCGAAATGTCCTATAGCTGGCTGCCGAGGTAAACTGAAGAGTAACAAAGTGG
TTTGTGATCCAATGCTCAAGTTTGAAATCGAGGAGCTGCGCACAATGAACAAACAATCTAATAGAGACGAAGTGATTGAA
GACTTCACAAATGCAGACGATGAAGATTAG