Details for Chinese cabbage Locus Brara.E02614

Position : A05 ( 5`- 23019495 .. 23022957 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02614

Protein [Map View]
MAGKEIFHKMKESVKEKVGLGASDSADSGKGKSKMSKQITHGFHLVKGKAFHEMEDYVVAKFKEVDDNELGLFAIFDAHL
SHEIPDYLCSHLFDNILNEPNFWQEPEKAIKKAYYITDTTILDKASDLGKGGSTAVTAILINCQKLVVANVGDSRAVLSK
GGVAKPLSVDHEPNMEKDDIENRGGFVSNFPGDVPRVDGQLAVARAFGDKSLKMHLSSEPYVTVEIIDDDAEFLILASDG
LWKVMSNQEAVDSIKGIKDAKSAAKHLSEEAVARKSSDDISVVVVKFQ*

DNA
ATGGCCGGTAAGGAAATTTTCCACAAGATGAAGGAATCCGTCAAGGAGAAAGTTGGGCTTGGTGCATCTGATTCTGCAGA
TTCAGGGAAAGGCAAGAGCAAGATGTCGAAGCAGATCACGCATGGTTTCCACTTGGTCAAAGGGAAAGCCTTCCACGAGA
TGGAAGATTACGTTGTTGCCAAATTCAAAGAAGTTGACGACAACGAGCTTGGCCTTTTCGCTATCTTCGATGCCCACCTT
AGCCACGAGATCCCTGACTACTTGTGCTCCCATTTGTTTGACAACATTTTGAATGAGCCAAATTTCTGGCAAGAACCAGA
GAAAGCGATCAAGAAAGCTTATTATATAACGGACACGACGATTCTAGACAAGGCATCTGACTTGGGGAAAGGCGGTTCCA
CTGCTGTGACTGCGATATTAATCAATTGCCAGAAGCTGGTGGTTGCTAACGTTGGCGACTCTCGTGCTGTTCTTAGCAAA
GGTGGTGTTGCCAAGCCACTCTCAGTTGATCACGAGCCTAACATGGAGAAGGATGATATAGAGAACAGAGGAGGATTCGT
TTCAAACTTCCCTGGGGACGTTCCTAGAGTTGATGGTCAACTGGCTGTGGCAAGGGCCTTTGGTGATAAGAGTTTGAAGA
TGCATTTGAGTTCAGAACCATACGTTACTGTGGAGATCATTGACGACGATGCGGAGTTTCTTATCCTAGCAAGTGATGGG
CTTTGGAAGGTCATGTCGAACCAAGAAGCGGTTGATTCGATTAAGGGAATAAAAGATGCAAAATCTGCAGCAAAGCACCT
CTCAGAGGAAGCTGTTGCAAGAAAAAGCTCAGATGATATCTCAGTGGTTGTCGTTAAATTTCAGTGA