Details for Chinese cabbage Locus Brara.E02613

Position : A05 ( 5`- 23017373 .. 23018158 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02613

Protein [Map View]
MPIRLSIKRLVTVNISKTHGGDVSGYVLRHATTRFDRLFTAFRQTESMRDRHDDRSTASYVSDKAKEGVKKATDAALNAG
DNMKDAMDGAWKAAKETGQNISEAVAGDDDTGDRIQEDKVAVELKDVSQPVDTTEYRGVEELHQQTDGENKSP*

DNA
ATGCCGATTAGGTTGTCGATTAAGAGACTCGTGACGGTGAACATTTCAAAAACTCATGGCGGAGATGTCTCCGGTTATGT
CCTCCGACACGCTACCACCCGGTTCGACCGCCTCTTCACCGCATTTAGGCAAACCGAGAGCATGAGAGACCGTCACGACG
ATAGGTCCACAGCGAGTTACGTGTCAGATAAGGCAAAGGAAGGGGTGAAAAAAGCGACGGATGCAGCCTTGAACGCAGGA
GATAACATGAAGGATGCCATGGACGGGGCCTGGAAAGCGGCCAAGGAAACGGGACAGAACATAAGCGAAGCCGTTGCCGG
AGATGATGACACCGGCGATAGGATTCAAGAGGACAAGGTCGCGGTGGAGTTGAAGGATGTGAGCCAGCCTGTTGATACGA
CTGAGTATAGGGGTGTGGAGGAACTACATCAGCAAACCGACGGTGAAAATAAGTCACCGTGA