Details for Chinese cabbage Locus Brara.E02608

Position : A05 ( 5`- 22979281 .. 22982178 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02608

Protein [Map View]
MEGSSNSNSRGFFNTSGVSDRNTERVTARSKPSLSHVDEYVRSVFGSSTRKSFEEDSLGVDDPFVRSLEWGDVSLRQWLD
KPERCVDVFECLHVFRQIVEIVNVAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSADSLEDDPVSHKKREDAGA
YNKILERQVEKLEEEKKQPFPMKHVLAMETSWYTSPEEEFGSPSTCASDVYRLGVLLFELFCPVPSREEKSRTMSSLRHR
VLPPQILLKCPKEASFCLWLLHPEPSCRPSMSDLLQSEFMTEPRDNLEEREAAIELRDKIEEQESLLEFLLMIQQRKQES
AYRLRDTVSLLSSDIEQVAKRQLVLKQKGSSFSDLSFPEEPSTLLASRKRFRQVIPPEETNDEESLFLESSRLMRNFKML
ETVYFLTRRRQLKASAALGKSLTRHSPLSSENGRGSEKSSVSNSAAPKDLSQNDSRQGGWIDPFLEGLCKYLSFSKLRVK
ADLKQGDLLNSSNLVCSLAFDRDGEFFATAGVNKKIKIFECDSIVNNNRDIHYPVVELASRSKLSCVCWNSYIKSQVASS
NFEGVVQIWDVSRSQLVTEMKEHKKRVWSIDISSADPTLLASGSDDGTVKLWSINQGASIGTIKTKANVCCVQFPSDSGR
SLAFGSADHKVYYYDLRNPKIPLSTMIGHSKTVSYVKFVDSSTLVSSSTDNTLKLWDLSMSASGVNETPLHSFAGHTNLK
NFVGLSVSDGYIATGSETNEVFVYHKAFPMPVMSYMFSNTDSTSGLEVDDASQFISSICWRGQSSTLVAANSNGNIKILE
MVA*

DNA
ATGGAAGGCTCTTCAAACTCCAACTCTAGAGGGTTCTTCAACACCTCTGGCGTTTCAGACAGGAACACTGAGAGAGTCAC
TGCTCGTTCGAAGCCTTCTTTATCTCATGTTGATGAGTATGTCAGAAGCGTGTTTGGTAGCAGCACACGCAAATCCTTCG
AAGAAGATTCTTTAGGGGTTGATGACCCTTTTGTTAGATCCTTGGAATGGGGTGATGTCAGCTTGAGACAGTGGCTGGAC
AAGCCTGAACGGTGCGTAGACGTTTTCGAGTGCTTGCACGTTTTCAGACAGATCGTGGAGATTGTGAATGTGGCTCACTC
TCAAGGCATTGTTGTTCATAACGTTAGACCTTCTTGCTTTGTCATGTCTTCGTTTAACCATGTTTCATTCATTGAGTCCG
CTTCTTGCTCTGACTCGGGGTCTGCTGATTCCTTGGAGGACGATCCAGTTAGCCATAAGAAAAGAGAGGACGCTGGAGCC
TATAACAAGATCTTGGAGAGACAAGTAGAGAAGCTAGAGGAAGAGAAGAAGCAGCCGTTTCCGATGAAACATGTGTTAGC
AATGGAGACAAGTTGGTACACAAGCCCTGAAGAGGAGTTTGGTTCTCCGAGTACTTGTGCTTCTGATGTCTACCGTCTTG
GTGTTCTTCTTTTCGAGCTGTTCTGTCCTGTGCCTTCAAGAGAAGAGAAGTCAAGAACTATGTCTAGTTTAAGACATCGT
GTGCTTCCGCCTCAGATATTGCTCAAATGTCCTAAAGAAGCTTCTTTCTGCTTGTGGCTACTGCATCCAGAGCCAAGCTG
TCGACCATCAATGAGTGACTTGCTGCAAAGCGAGTTTATGACCGAACCAAGAGATAATCTGGAAGAACGTGAAGCAGCAA
TAGAGCTTAGGGACAAAATCGAGGAACAAGAGTCGTTACTCGAGTTCTTGTTGATGATTCAACAGAGAAAGCAGGAGTCT
GCTTATAGATTGAGGGATACGGTTTCACTTCTTTCTTCAGACATAGAGCAAGTTGCGAAGAGACAGTTAGTTTTGAAGCA
AAAGGGAAGCTCATTCTCTGATCTCAGCTTCCCTGAAGAGCCTTCAACATTATTGGCTTCAAGAAAACGGTTTAGACAAG
TGATTCCCCCAGAGGAAACCAATGATGAGGAGAGCCTGTTTCTTGAAAGCTCCAGGTTGATGAGAAACTTCAAGATGCTA
GAAACCGTCTACTTTCTAACAAGGCGCAGGCAACTGAAAGCTTCTGCTGCTTTGGGGAAGTCGTTAACTAGACATTCACC
GTTAAGCAGCGAAAACGGAAGAGGTTCGGAGAAAAGCTCAGTAAGCAACTCTGCAGCACCCAAAGATCTTTCCCAAAATG
ATTCAAGACAAGGAGGGTGGATAGACCCTTTCCTTGAGGGTTTGTGCAAATACTTATCATTCAGTAAGCTCAGAGTGAAA
GCAGATTTAAAACAAGGAGACTTGTTGAACTCTTCTAACCTTGTTTGCTCCCTTGCGTTTGACCGAGATGGAGAGTTTTT
CGCCACTGCTGGTGTCAACAAGAAGATCAAGATCTTCGAATGTGACTCCATTGTAAACAATAACCGGGACATTCACTATC
CGGTTGTGGAGTTGGCTAGCCGGTCAAAGCTGAGCTGTGTGTGTTGGAACAGTTACATAAAGAGTCAGGTTGCATCAAGT
AACTTTGAAGGCGTGGTTCAGATATGGGATGTTTCAAGAAGCCAGTTGGTTACAGAGATGAAGGAGCACAAGAAGAGAGT
GTGGTCCATCGATATTTCATCAGCAGACCCGACTTTGCTGGCTAGTGGAAGCGATGATGGAACCGTTAAGCTATGGAGTA
TCAATCAGGGAGCTAGCATTGGAACCATCAAGACAAAGGCTAATGTATGTTGTGTCCAGTTTCCATCAGACTCTGGCCGG
TCTTTAGCATTTGGTTCTGCAGATCACAAAGTGTATTACTATGATCTTAGGAACCCCAAGATTCCTCTTAGCACAATGAT
TGGTCATAGTAAGACAGTGAGTTATGTCAAGTTTGTGGATTCGTCTACTCTTGTGTCTTCTTCTACTGATAACACGCTGA
AGCTTTGGGACTTATCCATGTCTGCCTCTGGTGTTAACGAAACGCCTCTTCATTCATTTGCTGGACACACTAATCTAAAG
AACTTTGTTGGCTTATCGGTCTCTGATGGGTATATAGCTACAGGCTCAGAGACTAACGAGGTTTTCGTGTACCACAAGGC
ATTCCCAATGCCGGTGATGTCGTACATGTTCAGCAACACTGACTCTACGTCTGGTCTAGAAGTTGATGATGCCTCACAGT
TCATATCTTCCATCTGCTGGCGAGGACAGTCGTCTACCTTAGTCGCTGCTAACTCCAATGGCAACATCAAGATTCTGGAA
ATGGTGGCATGA