Details for Chinese cabbage Locus Brara.E02605

Position : A05 ( 5`- 22969517 .. 22970210 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02605

Protein [Map View]
MSSCGNCDCADKTQCVKKGTSYTLDIVETQESYKEAMIMDVTGAEENGCQCKCGSSCSCVNCTCCPN*

DNA
ATGTCTTCGTGCGGAAACTGCGACTGTGCTGACAAGACCCAGTGCGTGAAGAAGGGAACCAGCTACACCTTGGACATCGT
CGAGACTCAGGAGAGCTACAAGGAAGCTATGATCATGGACGTTACTGGTGCAGAAGAGAACGGGTGCCAATGCAAGTGTG
GCTCTAGCTGCAGCTGCGTCAACTGCACTTGCTGCCCCAATTAA