Details for Chinese cabbage Locus Brara.E02601

Position : A05 ( 5`- 22959391 .. 22960765 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02601

Protein [Map View]
MEMKGKYLVTVILLVGTLSVGMCSNGWIRAHATYYGVNDSPASLGGACGYDNPYHAGFGAHTAALSGALFRNGESCGGCY
QVRCDYWADPKWCLRGAAVTVTATNFCPSNNNGGWCNLPRHHFDMSMPAFFRIARRGNEGIVPVFYRRVGCKRRGGVRFT
MRGQGNFNMVILSNVGGSGAVKAVAVRGSRGKTWRQMTRNWGANWQSSGDLRGQRLSFRVTLLDRKTMTFLNVVPSSWWF
GQTFSGRGQFL*

DNA
ATGGAAATGAAGGGAAAATATTTGGTAACGGTTATTTTATTGGTTGGTACGTTAAGTGTGGGGATGTGTTCTAATGGTTG
GATTAGGGCGCATGCAACGTATTATGGTGTTAATGATAGCCCTGCTTCACTTGGAGGAGCTTGTGGGTATGACAATCCGT
ACCACGCTGGATTCGGAGCCCATACGGCGGCGCTAAGCGGTGCGCTATTCAGAAACGGCGAGTCATGCGGTGGTTGCTAC
CAAGTGAGGTGCGACTATTGGGCTGATCCTAAGTGGTGTCTCCGAGGAGCCGCTGTGACGGTGACGGCTACAAACTTCTG
TCCGTCGAACAACAATGGAGGTTGGTGCAATCTCCCTCGCCACCACTTTGACATGTCCATGCCCGCTTTCTTCCGCATAG
CTCGCCGCGGCAACGAAGGCATCGTCCCCGTCTTCTACCGCCGAGTTGGGTGCAAAAGAAGAGGAGGTGTGAGATTCACG
ATGAGAGGTCAAGGGAATTTCAACATGGTCATACTCTCAAACGTTGGCGGCAGCGGCGCGGTGAAAGCGGTTGCGGTGAG
AGGCTCAAGGGGAAAGACTTGGCGTCAGATGACTCGTAATTGGGGCGCCAACTGGCAGAGCTCCGGTGATCTCCGTGGAC
AGAGACTCTCCTTCAGAGTTACTCTTCTTGACCGCAAGACGATGACGTTTCTAAACGTTGTTCCTTCTTCTTGGTGGTTC
GGCCAAACCTTCTCTGGTCGAGGCCAGTTCCTCTGA