Details for Chinese cabbage Locus Brara.E02599

Position : A05 ( 5`- 22951498 .. 22955547 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02599

Protein [Map View]
MSMIASSSHSDPDSRSLQVLLDAFGSRFSLDDIAAAYCQASQNVHEAGEILFAMTTKETPQSDQVKTNGATSKPTHVYVP
KKVQPRENDSNAAKVWRPKKSSVSVGTVSSVIGKEYARRSMPESNARQEAVKPMKIDARDIPETEIWSEEELPRSSEGNV
SRAPTDVEEFIAKMLGEGFQASPEVIQQILGVCGYDVIKSTEKLLDLSDTKKHADVGIFNEVTSKVDPQSSGEARTLTGS
QEGGKNNSGLEKEVLEALFSGAERYVEVPKVTRRFGERRARVAGRLVFEPLEDTFQESVVTVIQSTNTSKEDEDDENEYT
AHRKAVHENLQEMKEYYGAAVEAFSKGETERAHRLVEKGHFFGQKARDADDKSVAKMLELKEDDGSAYKEDEVVTVNVNE
HEPREALRLLKLQLRNFSGIPSIKYLRVKLGDNKEDSKCKRRRTAIAKLLAGESIAWSEEDNGLVMMIRVDEVIPEKLSF
AKK*

DNA
ATGTCAATGATTGCAAGCTCTTCCCACAGTGATCCAGATTCGAGAAGCCTGCAAGTCCTTCTCGATGCTTTTGGCTCTCG
TTTCTCTCTCGACGACATTGCTGCTGCCTACTGCCAAGCTAGCCAGAACGTCCATGAAGCTGGTGAGATTCTCTTCGCCA
TGACCACCAAAGAGACGCCTCAAAGTGACCAAGTGAAAACGAATGGAGCAACCTCAAAGCCAACTCATGTCTACGTTCCC
AAGAAAGTTCAGCCACGAGAGAATGATAGCAACGCCGCCAAAGTATGGAGGCCGAAGAAAAGTTCTGTATCAGTTGGTAC
TGTTTCAAGTGTTATTGGAAAGGAGTATGCTAGAAGAAGCATGCCTGAATCAAATGCTCGCCAAGAAGCAGTTAAACCGA
TGAAGATAGACGCAAGGGATATTCCTGAAACTGAGATATGGAGTGAAGAAGAATTGCCAAGAAGCAGTGAGGGAAACGTA
AGCAGGGCACCTACTGATGTTGAGGAGTTTATTGCTAAGATGCTCGGAGAAGGCTTTCAAGCTAGCCCTGAGGTTATTCA
GCAGATTCTTGGCGTATGCGGATATGATGTGATCAAGAGTACGGAGAAACTACTCGACTTGTCTGATACCAAGAAGCATG
CTGATGTTGGAATTTTTAATGAAGTTACTTCAAAAGTTGATCCTCAGAGCAGTGGTGAAGCAAGAACCCTAACAGGTTCA
CAGGAAGGAGGCAAGAACAATAGTGGTCTTGAAAAGGAAGTGTTAGAAGCTTTGTTCTCTGGTGCAGAAAGATATGTGGA
AGTACCAAAAGTAACTCGACGATTTGGAGAAAGGAGAGCAAGAGTTGCCGGCCGTCTTGTTTTTGAACCTCTGGAAGACA
CTTTTCAAGAGAGTGTTGTTACTGTGATACAATCAACAAATACATCTAAAGAAGATGAAGATGATGAAAATGAATACACG
GCACATCGTAAAGCAGTGCACGAGAATTTGCAGGAGATGAAAGAATACTACGGAGCTGCTGTAGAAGCATTCTCCAAAGG
AGAAACCGAGCGAGCACACAGACTCGTGGAGAAGGGACACTTTTTCGGACAAAAAGCTAGGGATGCAGATGACAAATCCG
TAGCAAAGATGCTTGAACTCAAGGAAGACGATGGCTCGGCTTACAAGGAAGACGAGGTCGTGACAGTAAATGTGAATGAA
CATGAACCAAGGGAAGCTCTTCGTCTTCTCAAGCTCCAACTTAGGAACTTCTCTGGCATTCCATCTATTAAGTACCTCAG
GGTCAAATTGGGTGACAACAAGGAAGACTCCAAATGCAAACGACGGCGTACGGCAATTGCCAAGTTGCTGGCGGGAGAAT
CCATTGCTTGGTCTGAAGAAGATAATGGCCTCGTGATGATGATTCGCGTTGATGAGGTTATCCCCGAGAAGTTGAGTTTT
GCCAAGAAATAA