Details for Chinese cabbage Locus Brara.E02596

Position : A05 ( 5`- 22941852 .. 22944533 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02596

Protein [Map View]
MAGGNWVVSFEDLPCHLILEVLTSGRLNAFDLLSLELTSKKVFGGSCFGLYPFKFRSLADYAASQLCSVHPVYVGMGLAT
QKELFANCEGNWKRLLRFLQSVEQSSDMVETSAGNMQVTTGRYHTLLINNSKVYSCGSSLSGVLAHGPETTQCVAFTPVE
FPFSAQVAQVSATQNHSAFVLQSGEVLTCGDNSSHCCGHLDISRPIFRPKLVEALKGTPCKQVAAGLHFTVFLSREGSVF
TCGSNTHGQLGHGDTLDRPVPKAVEFLQSVGPVVQISTGPSYVLAVTQDGSVYSFGSGSSFCLGHGEQQDEHQPRVIQAF
KRKGIHILRVSAGDEHAVALDSNGRVYTWGKGYCGALGHGDENDKITPQVLVSLNNCLAVQVCARKRKTFVLVEGGLLYG
FGWMGFGSLGFPDRGVSDKVLRPRVLECLKQHRVCQVSTGLYHTIVVTQGGRIFGFGDNERAQLGHDSLRGCLEPTEIFL
HCGRSRSRLC*

DNA
ATGGCTGGCGGAAACTGGGTTGTTTCGTTTGAGGATCTTCCTTGTCATTTGATCTTGGAGGTGTTGACATCTGGGAGGCT
CAATGCGTTTGATCTGCTCAGCTTGGAGCTGACCTCGAAGAAGGTTTTCGGAGGGAGCTGCTTTGGATTGTACCCTTTCA
AGTTCAGGTCGCTGGCTGATTACGCGGCGTCTCAGCTCTGCTCTGTGCATCCTGTCTATGTGGGAATGGGGTTGGCTACG
CAGAAGGAGCTTTTCGCTAATTGTGAGGGGAACTGGAAGAGGCTTTTGAGGTTCTTGCAGTCTGTTGAGCAGTCCTCTGA
TATGGTTGAAACCTCTGCAGGCAATATGCAAGTTACAACGGGAAGGTATCACACGTTGCTAATCAACAACTCAAAGGTGT
ACTCTTGTGGTTCGAGTTTGTCTGGTGTTCTTGCTCATGGACCAGAAACTACTCAATGCGTTGCGTTTACCCCTGTGGAG
TTCCCCTTCTCTGCTCAAGTGGCTCAAGTCTCAGCCACACAGAACCATTCTGCTTTTGTGTTGCAGTCTGGAGAGGTTCT
CACATGTGGGGATAACTCATCGCATTGCTGTGGTCACTTAGATATAAGTCGTCCAATATTTAGGCCTAAGCTTGTTGAGG
CTTTGAAGGGAACTCCTTGTAAGCAGGTTGCTGCAGGGCTTCACTTCACTGTGTTTCTATCAAGGGAAGGGAGTGTCTTT
ACTTGTGGATCAAACACACACGGACAGCTTGGTCATGGCGATACCTTGGACAGACCAGTACCCAAAGCTGTCGAGTTTCT
TCAAAGCGTTGGCCCTGTGGTGCAAATCTCAACGGGACCGAGCTATGTTTTAGCTGTGACACAAGATGGCTCGGTGTACT
CGTTTGGCTCTGGCTCTAGTTTCTGTCTTGGTCATGGAGAGCAGCAGGACGAGCACCAGCCGCGTGTTATTCAGGCTTTT
AAAAGAAAAGGTATTCATATACTCCGTGTCTCTGCAGGGGATGAACACGCCGTGGCACTTGATTCCAATGGCCGTGTATA
CACATGGGGTAAAGGTTACTGTGGTGCTCTTGGGCATGGAGATGAAAACGACAAGATCACTCCTCAAGTTTTGGTCAGTC
TCAACAACTGCCTCGCTGTCCAGGTGTGTGCAAGAAAGAGGAAAACTTTTGTGTTAGTTGAAGGTGGATTGTTGTATGGA
TTTGGGTGGATGGGATTTGGAAGCCTAGGGTTCCCTGACAGAGGAGTTTCCGACAAGGTCCTGAGGCCAAGAGTGTTGGA
GTGTCTGAAACAACACCGTGTGTGTCAAGTAAGCACCGGCTTGTATCACACCATTGTGGTGACTCAAGGTGGTCGCATAT
TCGGATTTGGGGATAACGAGAGAGCGCAGCTTGGTCACGACTCGCTCCGTGGCTGCTTGGAACCTACCGAGATCTTTCTT
CATTGTGGCCGTTCTCGTAGCCGACTTTGTTGA