Details for Chinese cabbage Locus Brara.E02595

Position : A05 ( 5`- 22939456 .. 22940494 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02595

Protein [Map View]
MLAIFQKAFAHPPEELNSPASHSSGKSPKLPGETLSDFLSLHKDTAFSMTFGDSAVLAYSRPQSSLRQRLFCGIDGIYCT
FLGALTNLCTLNRQYGLTGKNTSEAMFVIEAYRTLRDRGPYPADQVLRGLEGSFAFVVYDTQTSSVFSALSSDGGESLYW
GISGDGSVVMSDDVKIIKQGCAKSFAPFPTGCMFHSETGLKSFEHPRNEMKAMPRIDSEGVLCGANFKVDACSKVNGIPR
RGSEANWALANSR*

DNA
ATGTTGGCTATATTCCAGAAAGCTTTCGCTCACCCACCGGAAGAGCTCAACAGCCCGGCGTCTCACTCCTCCGGAAAATC
CCCAAAACTCCCCGGAGAAACCCTCTCCGACTTCCTCTCCCTCCACAAAGACACAGCTTTCTCCATGACCTTCGGCGACT
CCGCCGTCTTAGCCTACTCTCGCCCCCAAAGCTCTCTTCGCCAGAGGCTCTTCTGCGGTATAGACGGCATCTACTGCACC
TTTCTCGGCGCGTTAACCAACCTCTGCACGTTGAACCGACAGTACGGACTCACGGGGAAGAACACGAGCGAGGCAATGTT
CGTGATCGAAGCCTACCGAACGCTGCGTGACCGCGGTCCTTACCCTGCTGATCAAGTCCTCAGGGGGTTAGAAGGAAGCT
TCGCCTTTGTCGTCTACGATACTCAGACCTCCTCTGTTTTCTCGGCTCTGAGCTCTGATGGAGGAGAGAGTCTTTACTGG
GGGATCTCTGGCGATGGATCTGTTGTTATGTCTGATGATGTGAAGATTATAAAGCAAGGGTGTGCTAAATCTTTTGCTCC
TTTCCCTACTGGGTGTATGTTTCACAGTGAGACGGGGCTTAAGAGTTTTGAACATCCGAGGAACGAGATGAAGGCTATGC
CGAGGATTGATAGTGAAGGTGTGTTATGTGGAGCTAATTTCAAAGTGGATGCTTGTTCTAAGGTTAATGGGATTCCTAGG
AGAGGAAGTGAAGCTAACTGGGCTCTTGCTAATTCTCGTTAA