Details for Chinese cabbage Locus Brara.E02594

Position : A05 ( 5`- 22937198 .. 22939170 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02594

Protein [Map View]
MGRKRKHSEAEAAAPLKDDSAPERPQRTLLGWKDKKEDVEEAKEASAPSAPGFRNKEKVLVTCSRRISFRYRHLMLNIVS
LLPHCKKDSKVEAKSSKGATLNELVELKGSSSCLFFECRKHKDLYMWMVKSPSGPSVKFLVNAVHTMEELKLTGNHLKGS
RPLLTFSSNFDKDVHWKLLKEMLTQVFGIPKEHRKSKPYHDHVFAFSIVDDHIWFRNYQISVPHNEADKVARGGLDKMTL
VEVGPRFCLNPIKIFGGSFGGPTLYENPFYVSPNQIRALEKRNKAGKFAKKIKAKRRKKMHEISNPLEPDEFADMWKDDE
*

DNA
ATGGGGAGGAAGAGAAAGCACAGCGAGGCGGAAGCGGCGGCTCCGCTTAAGGACGACTCTGCTCCGGAGAGACCTCAGAG
AACTCTGTTAGGTTGGAAAGATAAGAAAGAAGATGTTGAGGAAGCTAAGGAAGCGTCTGCTCCGTCTGCGCCTGGTTTCA
GGAATAAAGAGAAGGTTCTCGTTACTTGTTCCCGTCGGATTAGTTTCAGGTATCGGCATCTGATGTTGAACATAGTTTCA
CTTCTGCCTCATTGTAAGAAAGATAGTAAGGTGGAAGCTAAGAGCAGTAAAGGCGCGACTCTTAATGAGCTTGTTGAGCT
TAAGGGCTCTTCTTCCTGCTTGTTCTTCGAGTGTAGGAAGCATAAAGATCTTTACATGTGGATGGTCAAGTCCCCTAGTG
GACCCTCTGTTAAGTTCTTGGTTAATGCTGTTCACACAATGGAGGAGCTGAAACTCACTGGAAACCATCTGAAAGGGTCA
CGCCCTCTCTTGACGTTCTCGTCCAATTTTGATAAAGATGTACACTGGAAACTCTTGAAAGAGATGTTAACACAGGTGTT
TGGAATCCCCAAGGAACACAGAAAGTCTAAACCTTACCATGACCATGTGTTTGCTTTCTCCATTGTCGATGACCATATCT
GGTTCCGTAACTATCAGATATCAGTACCTCATAATGAGGCAGACAAGGTTGCGCGAGGTGGTCTTGATAAAATGACCCTT
GTCGAGGTTGGTCCAAGGTTTTGTTTAAACCCGATTAAGATCTTTGGAGGCAGCTTTGGAGGTCCAACCCTTTACGAGAA
CCCATTCTACGTATCTCCAAACCAGATCCGAGCATTGGAGAAAAGGAATAAAGCAGGGAAGTTTGCAAAGAAGATCAAAG
CAAAAAGGAGGAAAAAGATGCATGAGATTTCAAACCCACTGGAGCCTGATGAGTTTGCAGACATGTGGAAGGATGATGAA
TGA