Details for Chinese cabbage Locus Brara.E02592

Position : A05 ( 5`- 22919714 .. 22921093 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02592

Protein [Map View]
MASKLVVIIVFILDLIAVGLAIAAEQRRSVGKVVTDTEKTYEYCVYGTDIATSYGAGAFLLLFISQVLIMSASRCFCCGK
SLNPGGSRACALLLFLICWVFFLVAEVCLLAASIRNAYHTQYRTMWNIDNPPSCEVIRKGVFAAGAAFTLFTAIVSQFYY
VCYSRARDAYQNPSY*

DNA
ATGGCTTCGAAGCTTGTAGTCATAATTGTGTTCATCCTCGATCTCATCGCGGTTGGTTTAGCCATTGCCGCCGAGCAGAG
AAGAAGTGTCGGCAAAGTTGTAACGGACACTGAGAAGACATATGAGTACTGTGTGTACGGCACGGACATTGCTACAAGCT
ATGGAGCTGGTGCGTTCCTTCTCCTCTTTATAAGCCAAGTCCTTATAATGAGTGCTAGCCGTTGCTTCTGCTGTGGGAAG
TCTCTTAACCCCGGCGGTTCAAGAGCTTGTGCTCTCCTTCTCTTCCTCATTTGCTGGGTATTCTTCCTGGTCGCTGAGGT
ATGTTTGCTTGCGGCATCGATCAGAAACGCGTACCACACACAATACAGAACGATGTGGAACATCGATAACCCACCAAGCT
GTGAAGTTATAAGGAAAGGAGTGTTTGCAGCTGGTGCTGCTTTTACACTATTCACCGCTATCGTCTCTCAGTTCTACTAC
GTATGCTACTCTCGTGCTAGAGATGCTTACCAGAATCCGTCCTACTAA