Details for Chinese cabbage Locus Brara.E02591

Position : A05 ( 5`- 22915429 .. 22916596 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02591

Protein [Map View]
MMFAKKTEQKFGCYCNVFAVWSRSSRWQKASKCKLHIQNLLCSVKVQRTRTECMVRQSRSDIAQLAPYGRFREALPKAKQ
FYEDERRLLAYDQVKYFCTSVLQSFSPLLNQNDVHLLPDETKESMAGLIFAASRIGELKELQIIRSLFVQRFGQKFDKDS
VDLRPGNLVSSEIVKILDTTMPQDAITPEIIMAISQKYQTDFITSVDSITEDSASLNNLGNADSDTLARRKKVTKENPKC
LHTDRGESQERDRSKFMR*

DNA
ATGATGTTTGCCAAGAAAACAGAACAGAAGTTCGGATGCTATTGTAATGTTTTTGCTGTTTGGTCTCGTTCTTCAAGATG
GCAAAAAGCTTCAAAGTGCAAACTCCATATCCAGAATCTGCTATGTTCTGTCAAGGTGCAACGAACACGAACAGAGTGTA
TGGTTAGACAGTCCCGGTCCGACATTGCTCAACTCGCTCCTTACGGCCGCTTTCGTGAAGCACTTCCTAAGGCGAAGCAG
TTCTATGAAGATGAGAGAAGGCTATTAGCTTACGATCAGGTCAAGTACTTCTGCACATCTGTATTGCAGAGTTTTTCTCC
TCTACTTAATCAAAACGATGTTCACCTCTTACCGGATGAAACGAAAGAATCAATGGCCGGACTGATATTTGCCGCATCAA
GAATCGGGGAGCTTAAGGAGCTACAAATCATAAGGAGCTTGTTCGTTCAAAGATTTGGGCAGAAGTTTGACAAAGATAGC
GTAGATTTGCGTCCAGGTAACCTAGTGAGCTCGGAGATAGTTAAGATTCTAGACACGACTATGCCGCAAGATGCAATTAC
TCCAGAGATCATAATGGCAATTTCACAAAAGTACCAAACCGACTTCATTACTTCCGTGGATTCAATAACTGAAGATTCAG
CTTCACTTAATAATCTTGGCAATGCTGATTCTGATACGCTTGCAAGGAGAAAGAAAGTCACGAAGGAGAATCCAAAGTGT
CTGCATACAGATCGTGGAGAGTCTCAAGAAAGAGATCGGTCAAAGTTCATGAGATAA