Details for Chinese cabbage Locus Brara.E02590

Position : A05 ( 5`- 22882310 .. 22883770 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02590

Protein [Map View]
MGIQELDPLAQLSLPPGFRFYPTDEELMVDYLCRKAAGHDFSLQLIAEIDLYKFDAWVLPSVIRRKRMVFLQPKGQEVSE
RVQTQPGCWIRYWKATGTDKVISTEGRRVGIKKALVFYVGKAPKGTKTNWIMHEYRLIEPSRRNGSTKLDDWVLCRIYKK
QSSAQKQAYGNLMTSASEYSNNGSSTSTSSHQYDDVLESLHEIDNRSLGYAAGSSHTIPHYNRRPGLTEQKTGFLDLARE
QSYNWTNFGGHNSVQELGRNLNVPSLRYGDGGGYLHGLKTNEEDDKTQQQQAEGIPQFNNSGVLAHDQSFSVDPVNGFGY
SGQQPSGFGFM*

DNA
ATGGGTATTCAAGAACTTGACCCGTTAGCCCAGCTAAGCTTACCACCGGGCTTCCGGTTTTACCCGACCGACGAAGAGTT
GATGGTTGATTATCTGTGCAGAAAAGCCGCCGGTCACGACTTCTCTCTCCAGCTCATCGCCGAGATTGATCTCTACAAAT
TCGACGCGTGGGTTTTACCAAGCGTTATTCGGAGAAAAAGAATGGTATTTCTTCAGCCCAAGGGACAGGAAGTATCCGAA
CGGGTCCAGACCCAACCGGGTTGCTGGATCCGTTATTGGAAAGCAACCGGTACCGATAAGGTTATCTCGACCGAGGGAAG
AAGAGTTGGTATAAAGAAAGCTTTGGTGTTTTACGTTGGAAAAGCACCAAAAGGTACCAAAACTAATTGGATCATGCATG
AGTACCGTCTCATCGAACCCTCTCGCAGAAATGGAAGCACCAAGCTTGATGATTGGGTCCTTTGTCGAATATACAAGAAG
CAATCAAGCGCGCAAAAACAAGCTTACGGTAATCTAATGACAAGTGCAAGTGAATACAGCAACAATGGTTCGTCCACGTC
AACTTCATCTCACCAATACGACGACGTTCTTGAGTCCTTGCATGAAATAGACAACAGAAGTTTGGGTTATGCTGCCGGTT
CATCACACACGATTCCTCATTATAATCGTAGACCGGGTTTAACCGAACAGAAAACCGGGTTTCTTGATTTAGCAAGGGAA
CAGAGTTATAATTGGACGAATTTTGGTGGACACAACTCGGTCCAGGAGCTAGGACGGAATCTTAACGTTCCAAGTCTCCG
TTACGGCGACGGTGGTGGCTATTTACACGGTTTGAAGACAAACGAAGAAGACGATAAGACGCAGCAACAACAAGCTGAGG
GGATTCCTCAGTTTAATAACTCGGGCGTGTTGGCTCATGATCAAAGTTTCAGTGTTGACCCGGTTAACGGGTTCGGGTAC
TCGGGTCAACAACCTAGTGGTTTCGGGTTTATGTGA