Details for Chinese cabbage Locus Brara.E02588

Position : A05 ( 5`- 22837533 .. 22845532 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02588

Protein [Map View]
MQAVRRIPSGEGAEMRGRSETNRVRRKSHGSSLRVRQPCTCSGRPGSSKCVRHGFLVPSDEKLMRKASDGSREVLRRALT
PPIRRMNLRCICIIKFKISNV*

DNA
ATGCAGGCTGTGAGAAGGATCCCATCAGGAGAAGGTGCAGAGATGCGTGGAAGATCCGAGACGAACCGGGTCAGACGTAA
GAGTCACGGGTCAAGTCTGAGAGTTCGACAGCCTTGCACGTGTTCAGGACGGCCTGGCTCTTCCAAGTGCGTGCGTCACG
GGTTTTTGGTGCCAAGCGATGAGAAGCTTATGCGGAAGGCGAGCGACGGAAGCAGAGAGGTGTTGAGGAGAGCTTTAACG
CCTCCGATCCGGCGGATGAATCTCCGATGTATATGTATAATTAAATTTAAAATTTCAAATGTATAA