Details for Chinese cabbage Locus Brara.E02587

Position : A05 ( 5`- 22833589 .. 22833795 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02587

Protein [Map View]
MVCFCFLVDQKRKMKASKPAAGMCSRCGRGARIADMKTSTRFCLIPIYCRSWRAIVCSFCGSVLKSYR*

DNA
ATGGTGTGTTTCTGTTTCTTGGTGGACCAGAAGAGAAAGATGAAAGCAAGCAAACCAGCGGCGGGAATGTGTTCTCGGTG
CGGTCGTGGTGCAAGAATCGCTGACATGAAGACTTCAACGAGGTTTTGTCTAATACCTATTTATTGCAGATCTTGGAGAG
CCATCGTCTGCAGCTTTTGCGGCTCTGTTCTTAAATCCTACCGTTGA