Details for Chinese cabbage Locus Brara.E02576

Position : A05 ( 5`- 22764003 .. 22766106 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02576

Protein [Map View]
MWRRIVSSHLKALVADVAAASPRRSTARPVHFHRADNPASSSSSSVIPRCFSSESVETIAKKKVEDVMPIATGHEKEEIE
AELEGRRLLDIDFPEGPFGTKEAPATVKSYYDKRIVGCPGGEGKDEHDVVWFWLEKGKSFQCPVCTQYFELEVVGPGGPP
DGHGDEDDEHHH*

DNA
ATGTGGAGAAGAATCGTATCCTCTCATCTCAAAGCCCTAGTCGCCGATGTCGCCGCTGCTTCTCCTCGTCGTTCCACCGC
GAGACCCGTTCACTTCCATCGCGCTGACAATCCTGCTTCTTCTTCTTCTTCTTCCGTCATCCCTCGCTGTTTCAGCTCCG
AATCAGTAGAGACAATAGCGAAGAAGAAGGTGGAGGATGTTATGCCCATTGCAACTGGGCACGAAAAGGAGGAGATTGAA
GCTGAACTTGAGGGGAGGAGGCTGCTTGACATTGACTTTCCCGAAGGTCCTTTTGGAACTAAGGAAGCTCCTGCTACAGT
AAAGTCCTACTATGACAAGCGTATTGTTGGATGCCCTGGTGGTGAGGGCAAGGATGAACACGACGTTGTGTGGTTCTGGC
TGGAGAAAGGAAAGTCTTTTCAATGCCCGGTTTGCACACAGTACTTTGAGCTAGAAGTGGTTGGTCCAGGTGGTCCTCCT
GATGGTCACGGTGATGAAGACGATGAGCATCACCACTGA