Details for Chinese cabbage Locus Brara.E02575

Position : A05 ( 5`- 22752747 .. 22754994 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02575

Protein [Map View]
MSYSHQSMGSGSRSGRGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLPNIICYEQIKWICPTAPSRPVS
LLGGFPCTAWFDVGEISEDLQDDIEGLDASAAHIANLLSTEPTDVKVGIGGFSMGAAIALYSTTCYALGRYGTGHPYTIN
LRATVGLSGWLPGWRSLRSKIESSNEAARRAASVPVILAHGTSDDVVPYRFGEKSAHSLAMSGFRQVVFKPYEGLGHYTV
PKEMDEVVQWLASRLGLEGWR*

DNA
ATGAGCTATTCTCATCAAAGCATGGGTTCTGGCAGTAGAAGTGGAAGAGGATATGAGTTTGGAAGGACTTATGTTGTGAG
GCCTAAAGGAAAACACCAAGCTACTATTGTTTGGTTGCACGGTCTTGGAGACAATGGCTCAAGCTCGTCTCAGCTCTTGG
AGAGTCTGCCTCTTCCAAACATTATATGCTATGAACAGATAAAATGGATATGTCCAACTGCTCCTTCTCGTCCTGTTTCG
CTTCTTGGCGGATTCCCTTGCACTGCATGGTTCGACGTAGGAGAAATTTCTGAGGATCTTCAAGATGATATAGAAGGCTT
AGATGCTTCAGCTGCACATATTGCTAACCTCTTGTCAACTGAACCAACAGATGTCAAAGTTGGGATAGGAGGTTTCAGCA
TGGGTGCAGCAATAGCTCTCTACTCCACAACGTGCTACGCTCTTGGACGTTATGGAACCGGACATCCTTATACTATAAAC
CTACGAGCTACTGTAGGACTTAGTGGTTGGCTTCCTGGTTGGAGGAGTTTAAGGAGCAAAATAGAAAGTTCTAATGAGGC
TGCAAGGCGTGCTGCATCAGTACCAGTTATACTTGCTCATGGAACTTCGGATGATGTAGTTCCTTACAGATTTGGAGAAA
AATCTGCGCATTCACTTGCTATGTCTGGATTCCGACAAGTTGTGTTCAAACCATATGAAGGGCTTGGTCACTACACAGTT
CCTAAGGAAATGGATGAGGTCGTTCAGTGGCTCGCTTCAAGGCTTGGTCTTGAGGGATGGCGTTAA