Details for Chinese cabbage Locus Brara.E02574

Position : A05 ( 5`- 22751500 .. 22752938 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02574

Protein [Map View]
MSAALSSKFLKGITSLQALRSTRLASASVYQHGMMRNSSTVPSDSDTHDDFKPTQKVPSGSTDSLKDIVENDVKENPVMI
YMKGVPEAPQCGFSSLAVRVLQQYNVPIGARNILEDQELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEEK
LKDVSGNQKSQ*

DNA
ATGTCCGCTGCTTTGTCGAGCAAGTTTCTTAAAGGAATCACAAGCCTTCAGGCTCTTCGTTCTACCAGATTGGCATCTGC
ATCTGTCTACCAACATGGGATGATGAGAAACTCCTCCACAGTGCCCAGCGATTCAGACACGCATGATGATTTCAAGCCTA
CACAGAAAGTCCCTTCTGGTTCTACTGACTCGTTAAAGGATATCGTTGAGAATGATGTGAAGGAGAATCCTGTTATGATC
TACATGAAAGGAGTTCCGGAAGCTCCTCAGTGTGGGTTTAGCTCACTAGCCGTAAGAGTTCTGCAACAGTATAATGTTCC
TATTGGTGCTAGAAACATTCTTGAAGATCAAGAATTGAAAAATGCTGTCAAATCTTTCAGCCATTGGCCTACGTTTCCAC
AGATCTTCATCAAGGGAGAGTTTATTGGAGGCTCAGACATCATCCTTAACATGCACAAGGAAGGTGAACTTGAGGAAAAG
CTTAAAGACGTCTCTGGAAACCAAAAGTCTCAATAA