Details for Chinese cabbage Locus Brara.E02572

Position : A05 ( 5`- 22740900 .. 22743549 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02572

Protein [Map View]
MASCSLGVPKIKISAAVDLSLVRSGRFQIPCNQRVLLIGQRPVKYLSLRATLGSVQASTVTAAESAATVEVEDTETTKPS
PLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLYVARNLADNNSSPPQPQPIPAAVASSATTESVDSNGSASSTS
LAITKPTSSAADQGLVILQSPKVGFFRRSKTIKGKRTPSSCKEKDQVKEGQVLCYIEQLGGQFPIESDVTGEVVKILRED
GEPVGYNDALISILPSFPGIKKLQ*

DNA
ATGGCTTCCTGTAGCCTGGGAGTTCCTAAGATTAAAATCTCAGCAGCAGTAGACCTCAGTTTAGTAAGATCTGGGAGGTT
TCAGATACCATGCAATCAAAGAGTGTTGTTGATTGGTCAAAGGCCGGTTAAGTACTTGAGTCTCAGGGCAACTCTTGGTT
CTGTCCAAGCGTCTACTGTCACAGCTGCTGAATCTGCAGCAACTGTAGAAGTAGAAGATACTGAGACGACGAAGCCATCT
CCGTTGAACGCTCAGCTCGTTCCCAAGCCCTCTGAGGTGGAAGCTCTTGTCACTGAGATATGCGATTCCTCATCAATTGC
AGAGTTTGAACTGAAACTGGGGGGTTTCCGCCTATATGTAGCGAGGAACTTAGCTGACAATAACAGTAGTCCACCACAAC
CTCAGCCAATTCCTGCTGCCGTGGCTTCAAGTGCAACCACGGAGAGTGTTGATTCGAATGGATCAGCTTCCTCTACTTCA
CTGGCAATCACAAAACCAACATCCTCAGCTGCTGATCAGGGTTTGGTGATTCTCCAGTCTCCAAAGGTAGGGTTCTTCAG
GAGATCCAAAACCATAAAGGGTAAACGCACTCCTTCGTCATGTAAAGAGAAAGACCAAGTGAAAGAAGGTCAAGTTCTGT
GCTATATTGAACAGCTCGGTGGCCAGTTTCCAATCGAGTCTGATGTTACCGGCGAGGTTGTCAAAATACTCAGAGAGGAT
GGAGAGCCTGTAGGATACAATGATGCTCTCATATCAATCCTTCCTTCCTTTCCTGGGATCAAGAAGCTTCAGTAG