Details for Chinese cabbage Locus Brara.E02569

Position : A05 ( 5`- 22733953 .. 22735303 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02569

Protein [Map View]
MGWIGETVDSIKSIKIRQLLTQAVTLGMIVTSALIIWKAMMCVTGTESPVVVVLSGSMEPGFQRGDILLLRMTKDPIRTG
EIVVFKIDGRDIPIVHRVIEVHERKTTGKVDVLTKGDNNDVDDIDLYADGQMWLHRHHIMGRAVGFLPYVGWVTIIMTEK
PIIKYLLIGAMGLLVITSKD*

DNA
ATGGGTTGGATCGGAGAAACAGTGGATTCCATCAAATCTATCAAGATCCGTCAGCTTCTCACTCAAGCCGTCACACTCGG
TATGATCGTGACGTCGGCATTGATAATATGGAAGGCTATGATGTGTGTGACTGGCACTGAATCTCCTGTAGTTGTTGTTC
TCTCTGGAAGCATGGAACCTGGCTTTCAGAGAGGGGATATATTGCTCTTGCGCATGACCAAGGACCCCATTAGAACAGGC
GAGATTGTTGTTTTCAAAATTGATGGTCGTGATATACCCATCGTCCATCGTGTCATTGAAGTTCATGAGAGGAAAACTAC
TGGAAAAGTTGATGTTCTAACAAAAGGTGACAACAATGATGTGGATGACATCGATCTCTACGCTGATGGACAAATGTGGC
TTCATCGCCACCATATAATGGGCAGAGCTGTTGGGTTCTTGCCTTATGTTGGATGGGTGACTATTATCATGACAGAAAAG
CCTATCATCAAGTATTTACTCATTGGTGCAATGGGTCTGCTCGTTATAACATCCAAAGACTGA