Details for Chinese cabbage Locus Brara.E02561

Position : A05 ( 5`- 22690275 .. 22690996 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02561

Protein [Map View]
MSSMLGCSSGTVAIATAMVFSSTALFLAMARQFHGKIHDQTPPPILRSCLSSEETKKQRKKKRVRFAGNVKDTKGNGKEY
RKRELSRRTVPEPVT*

DNA
ATGTCTTCCATGTTGGGTTGTTCTAGTGGCACCGTAGCGATCGCAACCGCCATGGTTTTCTCAAGCACTGCTCTGTTTCT
CGCGATGGCTCGACAGTTCCATGGGAAGATTCATGATCAAACTCCACCACCGATACTCCGTTCATGTCTATCTTCAGAGG
AAACGAAGAAGCAGAGGAAGAAGAAGAGAGTTCGCTTCGCGGGGAATGTGAAAGATACGAAAGGGAACGGGAAAGAGTAC
CGGAAGAGGGAATTGAGCAGGAGAACCGTACCGGAGCCAGTGACTTAA