Details for Chinese cabbage Locus Brara.E02559

Position : A05 ( 5`- 22687065 .. 22688021 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02559

Protein [Map View]
MGTDDEIVSVELPAPSSWKKLVFFPNKVKKTEIVFVSPTGEEISNRKQLEQYLKSHPGIPGSAKFDWTTSGTPRRRSARI
SEKTKSTPSPDKEPPKKRGRTKSSGSKKDTDEGDKPKGGVENSNVQEEDSEMTHPKEKGNVTVKDSFGEIEKADDMVSEE
KDKMS*

DNA
ATGGGTACAGACGATGAAATTGTATCTGTGGAGCTACCAGCACCTTCTTCATGGAAGAAATTGGTTTTTTTCCCCAACAA
AGTGAAGAAAACAGAGATTGTGTTTGTTTCTCCAACGGGCGAAGAGATCAGTAACAGAAAGCAGCTGGAGCAGTACCTCA
AGTCCCACCCTGGAATCCCTGGGAGCGCAAAGTTTGATTGGACCACTAGTGGGACACCTAGGAGGAGATCTGCAAGGATC
AGTGAGAAGACTAAGTCAACTCCCTCACCAGATAAAGAGCCACCCAAGAAACGAGGTCGGACTAAATCTTCAGGGTCAAA
GAAAGATACAGATGAAGGTGATAAACCAAAGGGAGGGGTGGAAAACTCTAATGTGCAAGAAGAAGATTCTGAAATGACTC
ATCCAAAGGAGAAGGGGAATGTAACTGTTAAGGATAGCTTTGGTGAAATTGAGAAGGCAGACGACATGGTGTCAGAGGAG
AAAGACAAAATGTCATGA