Details for Chinese cabbage Locus Brara.E02554

Position : A05 ( 5`- 22670918 .. 22672981 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02554

Protein [Map View]
MASLLTSPLTKPKPFFLSSPPRPLTAPPPLNLAGISLTHNQKLAPFKLPSLVSSAFKKRDVAASAAAASGTGDDYRRIML
SDVMVKKKTDKAVWWEREWTSMDFGAVAVVVSMHLLSLLAPFQFNWRAVSVAFVLYIVTGLLGITLSFHRNLTHRSFKLP
KWLEYLFAYCGAQALQGHPIDWVSTHRYHHQFCDSDKDPHSPLEGFWFSHMNWMFDTNTITQRVGEPNNVGDLEKQPFYQ
FLKNTYIWHPVALAAALYAMGGFPFIVWGMGVRIVWVYHITWLVNSACHVWGNQAWNTGDLSKNNWWVAALAFGEGWHNN
HHAFEFSARHGLEWWQFDMTWYVVRFLQAIGLATEVKLPSEAQKQRMALTSDSS*

DNA
ATGGCGTCTCTTCTCACCTCTCCCTTAACAAAGCCCAAACCTTTCTTCCTCTCTTCCCCTCCGCGACCTCTAACCGCGCC
ACCGCCGTTGAATCTCGCCGGAATCTCACTCACCCACAACCAAAAGCTCGCTCCTTTCAAGCTCCCGAGCCTAGTCTCCT
CCGCATTTAAGAAGAGAGATGTCGCCGCATCTGCTGCAGCTGCCTCGGGGACGGGAGATGATTACCGAAGGATAATGCTT
TCGGATGTGATGGTGAAGAAGAAGACGGACAAAGCGGTTTGGTGGGAGAGAGAGTGGACTTCTATGGATTTTGGCGCTGT
GGCTGTGGTTGTCTCGATGCATTTGCTTAGCCTCTTGGCTCCGTTTCAGTTTAACTGGAGAGCTGTTTCGGTTGCTTTTG
TGCTTTATATCGTGACGGGTCTCTTGGGGATTACTCTGTCGTTTCATAGGAATCTTACTCATAGAAGCTTCAAGCTTCCT
AAGTGGCTTGAGTACTTGTTTGCTTATTGTGGAGCTCAGGCTCTTCAGGGGCATCCGATTGATTGGGTGAGTACGCATAG
GTACCATCATCAGTTTTGTGATTCGGACAAAGATCCTCATAGCCCACTTGAAGGGTTTTGGTTTAGTCACATGAATTGGA
TGTTTGATACTAATACTATCACGCAAAGGGTTGGAGAGCCTAATAATGTTGGGGATTTGGAGAAGCAGCCGTTCTATCAG
TTCCTTAAAAACACCTACATTTGGCATCCGGTGGCTCTAGCGGCTGCTCTATACGCAATGGGTGGCTTCCCCTTCATCGT
TTGGGGAATGGGTGTAAGAATAGTATGGGTATATCATATAACTTGGCTAGTGAACTCAGCTTGTCACGTTTGGGGAAACC
AAGCTTGGAACACTGGAGACTTGTCTAAAAACAACTGGTGGGTAGCAGCTCTAGCTTTTGGAGAAGGATGGCACAACAAT
CACCATGCTTTCGAGTTCTCTGCTCGACATGGCCTTGAATGGTGGCAATTTGATATGACTTGGTACGTCGTTAGGTTCCT
CCAAGCTATTGGCTTAGCAACCGAGGTTAAGCTCCCATCAGAAGCTCAGAAACAACGAATGGCACTTACCAGTGATTCAT
CGTAA