Details for Chinese cabbage Locus Brara.E02552

Position : A05 ( 5`- 22643153 .. 22643653 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02552

Protein [Map View]
MDDNKNIIKTLARWCLVLQAIMISSNTVALKEPDYVNMNITIRNAMTGLLRPEIVYRCQSKRKDYGWHRSTKPGTQFSFP
IILIKGESKIPAIHICRFRSALGTATLVIENTYLDAEMCPKSSCAHEATPKGILFRGLEWDFKTVFPKLKPVEYLELPWT
PSPNRT*

DNA
ATGGATGATAACAAAAACATCATCAAAACCCTAGCTCGGTGGTGTCTTGTTCTACAAGCCATCATGATATCTTCCAACAC
CGTGGCTCTCAAGGAACCAGACTACGTAAACATGAACATAACAATCCGCAATGCAATGACCGGGCTGCTCCGCCCGGAAA
TCGTCTATCGATGCCAGTCCAAACGCAAAGATTATGGTTGGCATCGATCTACAAAACCAGGAACTCAGTTTTCATTTCCA
ATCATTCTCATTAAAGGTGAAAGCAAGATACCGGCTATTCACATCTGCCGTTTCCGGTCCGCTTTAGGAACCGCCACACT
CGTGATAGAAAACACTTATCTCGACGCCGAGATGTGTCCTAAATCTTCATGTGCTCACGAAGCGACACCGAAAGGGATCT
TGTTTAGAGGCCTTGAATGGGATTTCAAAACCGTGTTTCCAAAGCTCAAACCAGTTGAGTATCTTGAATTGCCGTGGACA
CCTTCGCCAAACAGAACATGA