Details for Chinese cabbage Locus Brara.E02546

Position : A05 ( 5`- 22577298 .. 22580149 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02546

Protein [Map View]
MGFLVGATCFAPSPPPPPLHTSSSTSQFLLLRSNNVAISKRRRPPPSASLRRQDANDGDVSVKRRDFVLMGVSVLPFLLF
RSPAMADERGGNEIKTSSKLNQQTEVAVSEEGTSPNPFLSLLNGLGIFSAGVLGALYALARQDTQAAEEAIDSLKNQLKD
RERALITKEKDFEARLQCEQEERNKERKKAQEDQLSLISQLNSAKEVVTGLGREISSEKKLCEELRVQIETLQSNLSKAG
EDKKALETTLSEKLDLVKELQDRINSLSLELKDKEEETQRISTLLAAKEAELEKLNSAYTQTSRDLAGAKSETKQLKEEV
TRSQTELELKNSTIEELNTRISTLEAEKESYIQKLDDVSKEYNALKLTSETRAAADAELISRKEKEIQDLKEKLDHALKD
LNESKDEVADLTEKYEDSKRMLDIEMTSVENLKHELEGTKKALRASRERVSDLEKLLDESRALCSKFESEVSVIHAEFEK
AKERYEENLAEERRNSESFASKLAVEKDHLKKAGEELEELTREVEESSVKNQSLQKELVEVYKKAETTKKELEEEKRTVL
ALDKEVKAMEKQMLMEKEARKSLETELEEAVKSLDEMNRNTSTLSKELEKVNSHVSSLEDEKEVIQRSLEEAKNASKEAK
ENVEDAHNLVISLGKEREALEKKVKKLEEDLGSAKGEILRMRSQQSSVKAVNSTDDEEKSDDKVTVKKAVRRRKSSTSS*

DNA
ATGGGTTTCCTCGTCGGAGCCACTTGCTTCGCTCCGTCTCCTCCTCCTCCTCCTCTCCATACTTCTTCTTCTACGTCGCA
GTTCCTGCTCCTTAGGTCCAACAATGTCGCTATCTCCAAGCGTCGCCGACCACCACCATCGGCTTCTCTACGCCGTCAAG
ATGCAAACGACGGCGATGTTTCCGTCAAAAGAAGAGATTTTGTCCTTATGGGTGTCTCTGTTCTTCCGTTTTTGCTGTTC
CGATCACCAGCTATGGCTGATGAAAGAGGAGGCAATGAGATAAAGACATCATCGAAGCTTAATCAACAAACTGAGGTTGC
AGTAAGTGAAGAAGGAACATCCCCAAATCCGTTTCTGTCTCTCTTAAACGGTCTTGGAATCTTCAGCGCTGGTGTTCTTG
GTGCACTCTATGCCCTGGCTCGGCAAGACACACAAGCTGCTGAAGAAGCCATCGATTCTCTAAAGAACCAGTTGAAAGAC
AGAGAAAGAGCATTGATTACCAAGGAGAAAGACTTTGAAGCAAGACTGCAGTGTGAACAGGAAGAGCGGAACAAGGAGCG
TAAAAAGGCACAAGAGGATCAGTTGTCATTGATCAGCCAGTTGAATTCTGCAAAGGAGGTGGTGACAGGATTAGGCCGGG
AGATAAGCAGCGAAAAGAAACTATGTGAGGAGCTTAGAGTTCAAATCGAAACTCTACAAAGTAATCTATCAAAGGCTGGT
GAAGACAAAAAGGCACTTGAAACAACGCTTAGTGAAAAGCTTGATTTGGTTAAGGAGCTACAAGATCGGATCAACTCACT
TAGTTTGGAGTTGAAAGATAAGGAAGAAGAAACTCAACGCATTAGCACATTACTGGCTGCAAAGGAAGCAGAACTGGAGA
AACTCAACTCTGCTTACACTCAAACTAGCCGAGATCTTGCTGGAGCAAAATCAGAAACCAAACAGCTAAAAGAAGAAGTC
ACAAGAAGTCAAACTGAGTTGGAGTTAAAGAACTCTACCATTGAGGAGCTCAACACCAGAATAAGCACTTTAGAGGCTGA
GAAGGAGAGTTACATCCAAAAGCTTGATGATGTCTCAAAAGAGTACAATGCTTTGAAATTGACTTCTGAAACGCGAGCAG
CTGCTGATGCAGAGCTCATTAGCAGGAAAGAGAAGGAGATTCAGGACCTAAAGGAAAAGCTGGATCATGCGCTTAAGGAT
CTAAATGAGAGTAAAGACGAAGTTGCTGACCTTACTGAGAAGTACGAAGACTCTAAGAGAATGCTGGATATAGAAATGAC
TAGTGTAGAAAACTTGAAACATGAGCTTGAAGGAACCAAGAAAGCACTCCGGGCGTCGAGAGAACGTGTCTCTGACCTGG
AGAAGCTGCTGGATGAGTCGAGAGCTTTGTGTTCAAAGTTTGAATCAGAGGTTTCTGTTATTCACGCAGAGTTTGAGAAA
GCTAAGGAAAGATATGAAGAGAATCTTGCCGAGGAAAGAAGAAACAGTGAGAGTTTCGCTAGCAAACTTGCAGTGGAGAA
AGATCATCTGAAGAAAGCTGGAGAAGAGCTTGAAGAACTGACACGTGAAGTGGAAGAATCTTCTGTCAAGAACCAGAGCC
TCCAGAAGGAACTAGTGGAGGTTTACAAGAAAGCCGAAACCACTAAGAAGGAACTGGAAGAGGAGAAGAGGACGGTTTTG
GCATTAGACAAAGAGGTGAAAGCAATGGAGAAGCAGATGTTGATGGAGAAGGAGGCGAGGAAGTCCCTTGAAACAGAACT
CGAAGAAGCAGTCAAGTCCTTAGATGAGATGAACAGAAACACATCGACGCTGTCGAAGGAGCTTGAGAAGGTGAATAGCC
ATGTCTCGAGTTTGGAAGACGAGAAAGAAGTGATTCAAAGATCACTAGAAGAGGCGAAGAATGCATCAAAAGAAGCTAAG
GAAAACGTGGAAGACGCACATAACCTTGTGATAAGTCTAGGAAAAGAGAGGGAAGCGCTAGAAAAGAAAGTGAAGAAACT
AGAGGAGGACTTGGGCTCTGCAAAGGGAGAGATACTGCGTATGAGGAGCCAACAGAGTTCTGTAAAAGCTGTGAATAGTA
CAGATGATGAAGAGAAGAGTGATGATAAGGTTACTGTGAAGAAAGCTGTTAGGAGGAGAAAGAGCAGTACCAGTTCTTGA