Details for Chinese cabbage Locus Brara.E02544

Position : A05 ( 5`- 22571667 .. 22572633 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02544

Protein [Map View]
MSSKQGGKLKPLKQPKSGKKEYDEHDKELMQKKKDEEKALKELRSKASQKGSFGGAGLKKSGKK*

DNA
ATGTCTTCCAAGCAAGGAGGGAAATTGAAACCCTTGAAGCAGCCCAAGTCTGGTAAGAAGGAATATGATGAGCACGATAA
GGAGTTAATGCAGAAAAAGAAGGATGAAGAGAAGGCACTTAAAGAACTCAGGAGCAAGGCATCACAAAAGGGATCATTCG
GTGGTGCTGGGCTTAAGAAAAGTGGCAAGAAATGA