Details for Chinese cabbage Locus Brara.E02541

Position : A05 ( 5`- 22564213 .. 22565384 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02541

Protein [Map View]
MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLKNVPRRFKTGFRE
GTEAKPRNKGAAASSA*

DNA
ATGACAAAGGGAACAGGGAGTTTTGGTAAGAGGAGGAACAAGAGTCACACACTATGTGTGAGATGTGGACGTCGTAGCTT
CCACATCCAGAAGAGTCGTTGCTCTGCCTGCGCTTACCCCGCCGCTCGCAAGAGGACCTACAACTGGAGTGTGAAGGCAA
TCAGGAGGAAGACAACCGGAACCGGAAGGATGAGGTATCTCAAAAATGTTCCCCGCCGTTTCAAGACCGGTTTCAGAGAA
GGTACTGAAGCCAAGCCAAGGAACAAGGGAGCAGCTGCTTCATCAGCCTAA