Details for Chinese cabbage Locus Brara.E02539

Position : A05 ( 5`- 22557524 .. 22558112 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02539

Protein [Map View]
MLEGKAKVEDTDMPVKMQMKALNIASQSLDLFDVSDCQPIAAHIKKEFDERYGSGWQCVVGSNFGCFFTHSKGTFIYFHL
GTLNFLIFKGATL*

DNA
ATGCTGGAAGGGAAAGCAAAGGTGGAAGACACAGATATGCCAGTGAAGATGCAAATGAAAGCATTGAACATTGCTTCTCA
ATCTCTCGATCTTTTTGATGTATCTGATTGTCAACCTATCGCTGCTCACATCAAGAAGGAGTTTGATGAGAGATATGGAA
GTGGTTGGCAATGCGTGGTGGGATCAAACTTTGGGTGTTTCTTCACACATTCTAAAGGAACTTTCATCTATTTCCATTTG
GGAACCCTCAACTTCCTCATCTTCAAAGGAGCCACTCTTTAG