Details for Chinese cabbage Locus Brara.E02538

Position : A05 ( 5`- 22553552 .. 22554483 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02538

Protein [Map View]
MASLATVAAVKPSVAVKGLGGSSLAGAKLSFKPSRLSIKTKSIRSGGVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPS
PYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSASSTGDVLPIKRGPQEKPKLGPR

DNA
ATGGCGTCTCTTGCAACTGTCGCCGCCGTGAAACCATCCGTGGCCGTAAAAGGCCTTGGCGGAAGCTCACTCGCCGGAGC
CAAGCTCTCCTTCAAGCCTTCCCGCCTAAGCATCAAAACCAAATCAATCCGGTCTGGTGGTGTGGTGGCTAAGTATGGAG
ACAAAAGTGTCTACTTTGACTTAGAAGATTTGGGAAACACAACAGGTCAATGGGATCTATACGGCTCTGATGCTCCTTCT
CCTTACAACCCTCTTCAGAGCAAGTTCTTTGAGACATTCGCCGCACCATTCACAAAGAGAGGACTGCTCCTCAAGTTCTT
GATCCTCGGAGGAGGATCTTTGCTTACTTATGTCAGCGCTTCCTCCACCGGTGATGTCCTTCCCATCAAGAGAGGTCCTC
AGGAGAAGCCTAAGCTCGGTCCTCGC