Details for Chinese cabbage Locus Brara.E02537

Position : A05 ( 5`- 22534663 .. 22536193 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02537

Protein [Map View]
MGRWAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVIRELETDPLFNSGRGSALTEQGTVEM
EASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEEFARKQGVEIVDNDYFVTDDNVGMLKLAKEANSI
LFDYRIPLGCAGAAVTDSPIVMNGLPISIYAPETVGCVVVDREGRCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASELCG
VSCTGEGEAIIRSTLARDVSAVMEYKGVGLQEAVDYVIKHRLDEGFAGLIAVSNKGEVVCGFNCNGMFRGCATEDGFMEV
AMWE*

DNA
ATGGGTAGATGGGCAATCGCAGTACACGGTGGCGCAGGAATCGACCCAAATCTTCCCGTAGAGAGACAAGAACAGGCGAA
ACAGCTTTTAACTCGCTGTCTTAACCTCGGCATAGCAGCTTTACGTTCCAACGTCTCCGCCATTGACGTCGTTGAGCTCG
TCATTAGAGAATTAGAGACAGATCCTCTGTTTAACTCAGGCCGTGGATCTGCTTTGACGGAACAAGGAACGGTGGAGATG
GAAGCAAGCATTATGGACGGTACGAAGAGACGATGCGGCGCCGTTTCGGGGATAACCACCGTGAAGAACCCTATTTCTCT
CGCTCGTCTCGTCATGGACAAATCTCCCCACTCTTACCTAGCCTTCTCAGGCGCGGAGGAGTTCGCTCGCAAACAGGGAG
TTGAAATTGTGGACAACGATTACTTTGTCACGGACGACAACGTGGGGATGCTCAAGCTGGCAAAAGAAGCCAACTCCATC
TTGTTTGATTACCGTATCCCGCTAGGATGCGCCGGTGCAGCCGTAACCGACAGTCCTATAGTGATGAATGGTCTTCCGAT
CAGCATTTATGCGCCGGAGACAGTGGGATGCGTGGTGGTTGACAGAGAAGGACGTTGTGCTGCGGGAACATCAACGGGTG
GTCTGATGAACAAGATGATGGGAAGGATAGGAGACTCGCCGTTGATAGGAGCCGGTACGTATGCGTCTGAGCTTTGTGGT
GTGTCGTGTACAGGAGAAGGAGAAGCTATCATAAGGTCGACGCTAGCGCGTGACGTGTCGGCTGTAATGGAGTATAAAGG
TGTTGGGCTTCAAGAAGCGGTTGATTATGTTATCAAGCATCGACTGGACGAAGGGTTCGCTGGACTTATTGCTGTGTCGA
ATAAAGGAGAGGTGGTTTGTGGTTTTAACTGTAATGGGATGTTTAGAGGATGTGCAACTGAAGATGGGTTCATGGAAGTT
GCTATGTGGGAGTGA