Details for Chinese cabbage Locus Brara.E02534

Position : A05 ( 5`- 22514183 .. 22515647 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02534

Protein [Map View]
MAERWTNTALLVIDMQNDFIEEGSVTQVKGGKAIVPNVIGVVELARQRGILVVWVVREHDPQGRDVEIFRRHHYRSEKVG
PVVKGTLGSKLVDGLNIREEEDYKIVKTRFSAFFGTHLHSFLQTSGITKLVIAGVQTPNCIRQTVFDAVELDYPDVTVIV
DATAAATPEIHTANLLDMRNIGVKTPTLHEWSEEFA*

DNA
ATGGCAGAGAGATGGACGAACACGGCTCTACTCGTTATCGATATGCAGAATGATTTCATAGAAGAAGGTTCTGTGACGCA
AGTGAAAGGCGGAAAAGCCATAGTTCCTAATGTTATCGGAGTGGTCGAACTCGCTAGGCAGCGTGGCATACTAGTTGTTT
GGGTTGTTAGAGAACACGATCCTCAAGGACGAGATGTTGAGATTTTCAGGCGTCATCACTACCGTTCTGAGAAAGTTGGA
CCGGTTGTTAAAGGAACCTTAGGTTCAAAGCTGGTAGATGGATTGAACATCAGAGAAGAAGAAGACTATAAGATAGTGAA
GACCCGTTTCAGCGCGTTCTTCGGCACGCATCTCCATTCGTTCCTTCAAACTTCAGGGATTACCAAGTTAGTTATCGCTG
GTGTTCAAACGCCAAATTGTATCAGGCAAACGGTATTTGATGCAGTGGAACTGGATTATCCAGATGTAACTGTTATTGTA
GATGCCACGGCTGCTGCAACACCAGAGATTCATACTGCGAATCTTCTGGACATGAGGAACATCGGCGTCAAGACTCCTAC
GTTACACGAGTGGTCTGAAGAATTTGCATGA