Details for Chinese cabbage Locus Brara.E02527

Position : A05 ( 5`- 22486381 .. 22487103 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02527

Protein [Map View]
MTSSNSSSSPTSSSSDQSDVTTTTSTHLSETSPKNNKRKRSNDSSSSSCSSSSKLKHPVYRGVRMRSWGKWVSEIRQPRK
KTRIWLGTFATADMAARAHDVAALAIKGSSAVINFPELASVLPRPASSSPHDIQAAAAEAAAMVVDGKLSESAKTEMKEA
PPSPESSESKEEERLEEIVELPNIEEGSYDMSVKSRSDLDYSEPLDCWVYPPPVMDLYEEFLEFDFLELWSFPHTELINP
*

DNA
ATGACGTCATCCAACAGTTCTTCATCACCAACATCATCGTCTTCGGACCAATCTGATGTAACTACAACAACAAGCACCCA
CTTGTCCGAAACTTCACCGAAAAACAACAAAAGAAAGAGAAGCAATGATTCTTCTTCTTCTTCTTGTTCCTCTTCTTCAA
AGCTTAAGCATCCTGTTTACAGAGGTGTACGGATGAGAAGCTGGGGCAAATGGGTCTCCGAGATCCGACAGCCTCGCAAA
AAGACTAGAATCTGGCTCGGTACATTCGCCACCGCAGACATGGCGGCGCGTGCTCACGACGTCGCTGCTCTCGCCATCAA
AGGCTCCTCCGCCGTCATCAACTTCCCGGAGCTAGCCTCTGTCCTCCCTCGTCCGGCGTCATCTTCGCCGCATGATATCC
AAGCAGCAGCTGCGGAAGCCGCCGCCATGGTGGTCGACGGAAAATTGTCAGAGTCTGCTAAAACAGAGATGAAGGAAGCA
CCACCGTCGCCGGAATCTTCGGAGTCTAAGGAGGAGGAGAGGTTGGAGGAGATTGTGGAGCTGCCTAACATTGAAGAGGG
GAGTTATGACATGAGCGTGAAGTCACGCTCCGACCTGGATTATTCTGAGCCGTTGGATTGTTGGGTGTATCCTCCTCCGG
TTATGGATCTTTATGAAGAGTTCTTGGAGTTCGACTTCTTGGAGTTATGGAGCTTTCCTCACACGGAACTGATTAATCCT
TAA