Details for Chinese cabbage Locus Brara.E02524

Position : A05 ( 5`- 22475838 .. 22478203 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02524

Protein [Map View]
MSAHRTPKTGRQSLLFQDLASPVSARRGKFSTPGQAAAVSALWRENLGGSDLPPPPMYTLDDRSDFSPESGIADYSASPD
VKSERRTPFQSSGKNVVTPGKGKLEASPSFSLLSGQQQSQQVSGSPSWWSQSKGGGSSAEQEDKGKGSPVEGVVQPGALV
TLPPPREVARPEVQRQVIPTGNVQEEEWVTVYGFPPSDTNLVLREFEKCGMIVKHVPGPRNANWMHILYQNRSDAQKALS
KTGMMINGVVIVGVKPVDPIQRQALNERLNNQGFMPLPPPSSTRDTEFNAARGASSRPHYLQNGSAFSPQPNGGAMAVPS
KSMVSKFVDLMFGV*

DNA
ATGAGTGCTCACAGGACTCCTAAAACAGGGAGGCAATCTCTCCTCTTTCAAGATTTAGCTTCTCCCGTCTCAGCGCGCCG
CGGAAAGTTCTCGACCCCGGGGCAAGCAGCTGCTGTATCTGCACTATGGCGTGAGAATCTCGGAGGCTCCGATCTTCCAC
CTCCGCCAATGTATACTCTCGATGACCGGTCTGATTTCTCTCCGGAGTCTGGCATTGCAGACTACTCAGCGTCTCCGGAT
GTCAAATCCGAGAGACGGACGCCTTTCCAGAGCTCTGGGAAGAACGTTGTGACTCCCGGTAAAGGGAAGTTGGAAGCGAG
TCCGTCTTTTTCGCTGCTGAGTGGGCAGCAGCAGAGTCAGCAGGTTTCCGGGAGTCCGAGTTGGTGGTCGCAGTCGAAGG
GAGGTGGGAGTAGTGCGGAGCAGGAGGATAAAGGGAAGGGGTCTCCTGTTGAAGGGGTGGTTCAGCCAGGTGCTTTGGTT
ACTCTTCCGCCACCGAGGGAAGTTGCTAGGCCTGAGGTTCAGAGGCAGGTTATACCCACAGGGAATGTTCAGGAGGAAGA
GTGGGTCACTGTCTATGGGTTTCCTCCAAGTGATACAAATTTGGTACTAAGAGAGTTTGAAAAGTGTGGTATGATCGTGA
AACATGTTCCGGGTCCAAGGAATGCCAACTGGATGCACATTCTCTACCAGAACCGGTCTGACGCACAGAAGGCCCTGAGC
AAAACCGGGATGATGATAAACGGAGTGGTAATAGTAGGTGTAAAGCCAGTAGACCCGATACAGAGACAAGCTTTAAACGA
AAGACTGAACAACCAAGGATTCATGCCTTTACCTCCACCATCATCCACCAGAGACACCGAGTTCAACGCAGCTAGGGGGG
CCTCCTCTCGTCCTCACTACTTGCAAAACGGAAGCGCCTTCTCCCCTCAACCAAATGGAGGTGCCATGGCCGTTCCATCA
AAGTCGATGGTCTCAAAGTTCGTCGACCTGATGTTCGGTGTTTAA