Details for Chinese cabbage Locus Brara.E02518

Position : A05 ( 5`- 22436534 .. 22438833 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02518

Protein [Map View]
MTRRCSHCSYNGHNSRTCPTRGGGGGTCGGNGGGSSASSSSSSAVKLFGVRLTDGSIIKKSASMGNLSALAVHHRLSPSS
PLATGNHNDSPLSDHGRYSSQDNGGYLSDDPGHGSGSIHHRRVERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRNYVT
SRTPTQVASHAQKYFIRHTCSSRRKRRSSLFDMVTDEMVTDPSPTQEDQTLSKEPESKTFLPSLELKLNNATESEAAPPQ
EQPEEAVEPPNGLSPMLVPGSFFPPCFPVTYTIWLPATSTSLQGTEPSLEVSASFQQHQVLKPKPGFAKERSNMDELVGM
SQLSIGMETSHETETPMSLKLIGEPSRPSAFHSNGSVSGSGLSKGSSAIQAT*

DNA
ATGACTCGTCGGTGTTCGCATTGTAGCTATAATGGGCATAACTCCCGCACGTGTCCGACTCGTGGGGGTGGTGGTGGCAC
GTGCGGTGGAAACGGAGGAGGATCTTCTGCTTCTTCCTCCTCCTCCTCTGCCGTGAAGCTGTTCGGCGTGAGGTTAACGG
ATGGGTCGATTATCAAGAAGAGTGCGAGTATGGGTAACCTCTCTGCATTGGCCGTGCACCACCGCTTGTCTCCGTCGTCT
CCTTTGGCGACGGGTAATCATAATGACTCGCCGTTGTCGGATCATGGGAGGTACTCTAGTCAGGATAACGGAGGGTATTT
GTCGGATGATCCAGGTCATGGTTCTGGGTCTATCCACCACCGTCGTGTGGAGAGGAAGAGAGGTGTTCCTTGGACTGAGG
AGGAGCACAGGCTATTCTTAGTGGGTCTTCAGAAGCTAGGCAAAGGAGATTGGCGTGGTATTTCAAGAAACTATGTGACT
TCAAGAACTCCTACACAAGTGGCTAGTCATGCTCAAAAGTATTTCATCCGCCATACTTGTTCCAGCCGTAGAAAAAGACG
TTCTAGCCTCTTCGACATGGTTACCGATGAAATGGTAACCGATCCATCGCCAACACAGGAAGACCAAACCTTAAGCAAGG
AGCCTGAAAGCAAAACCTTCCTTCCTTCACTTGAGCTCAAACTCAACAATGCTACAGAATCTGAAGCGGCGCCACCACAG
GAGCAACCTGAGGAAGCGGTAGAGCCACCAAACGGGCTTTCACCAATGCTAGTCCCAGGCAGCTTCTTTCCTCCTTGCTT
TCCAGTCACTTACACGATTTGGCTCCCTGCGACTTCCACTTCACTTCAAGGAACAGAGCCTTCCTTAGAAGTCTCAGCTT
CTTTTCAGCAGCATCAGGTCCTCAAACCAAAACCTGGATTTGCTAAAGAACGCTCCAACATGGACGAGCTGGTCGGTATG
TCTCAGCTTAGCATAGGAATGGAGACAAGTCATGAAACCGAGACTCCCATGTCTCTGAAACTAATAGGAGAGCCGTCAAG
GCCATCTGCGTTTCACTCCAATGGCTCCGTTAGTGGCTCGGGTTTGAGTAAAGGCAGCAGCGCGATTCAGGCGACCTGA