Details for Chinese cabbage Locus Brara.E02515

Position : A05 ( 5`- 22407288 .. 22409704 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02515

Protein [Map View]
MAAIVKTEMQAVGNIQSSSLASLYVGDLSPDVTEADLTAKFSLTVPVVSAHLCRDSVTAKSLRYAYVNFDSAITASNAMA
CLNHTDLKGKTMRIMWSQKDVAYRRRSGLGNLFVKNLDSSITSSCLERMFSPFGVILSCKVAEENGQSKGFGFVQFATEQ
SAVAARLASHGSMVDGKKLFVAKFINKDERAAMSGNQEFTNVYVKNLLESVTEDFLHTMFSQCGTVSSVVVMRDGMGRSR
GFGFVNFCHPENAKKAVESLNGKPHGTKKLFVGRALRKAERMEMLKQKHKDNFVAKFNVGWFNLYVKNLSEAINETRLRE
IFGSYGKIVSAKVMRDENGKSKGFGFVAFSTLDESKHAKRELHGFIVDGQSLVVRVAERKEDRFKRMQQYHPVQSRHYMQ
AAPVPSAAQPVPPSMEYKQYYGVQPPRNYTQALPVPSPAQPVPPPSMSSSPYGYLQPFHIGAYYYPMATQVPQMSGHQNM
TTYVPAGQAHLKEKRSVQLVYKRPGYTTFVKSGAKQKLVFKGQGDKTLEAGTCSTKGKTSAEKRKEVSSHLMAMLTPNRN
AAENLATLEVA*

DNA
ATGGCGGCGATCGTGAAAACGGAAATGCAAGCCGTAGGAAACATCCAGTCCTCGAGCCTCGCTTCGCTTTACGTCGGCGA
TCTTAGCCCCGACGTGACGGAGGCTGATCTCACCGCCAAATTCTCCTTGACTGTCCCCGTCGTCTCCGCTCATCTCTGCC
GCGACTCCGTCACCGCCAAATCACTGCGTTACGCTTACGTCAACTTCGATTCCGCCATCACCGCGTCGAATGCTATGGCG
TGCTTGAACCACACCGATCTGAAGGGGAAGACGATGCGTATAATGTGGTCTCAGAAAGACGTTGCGTACCGTCGTCGTAG
TGGATTGGGGAATCTCTTCGTTAAGAATCTTGACAGCTCCATCACTAGCAGCTGCTTAGAGCGGATGTTTAGTCCCTTCG
GAGTCATACTTTCTTGCAAAGTAGCTGAGGAGAATGGCCAGAGTAAAGGCTTCGGTTTTGTTCAGTTTGCTACGGAGCAG
TCTGCTGTTGCTGCTCGTCTTGCCTCCCACGGCTCTATGGTTGATGGCAAGAAACTGTTTGTGGCTAAGTTCATTAACAA
GGATGAAAGAGCTGCTATGTCTGGGAATCAAGAGTTCACAAACGTTTATGTGAAGAATCTGCTCGAGAGTGTTACAGAGG
ATTTTCTCCATACGATGTTTTCTCAGTGTGGGACGGTGTCTAGTGTTGTGGTTATGAGGGATGGTATGGGAAGATCGAGA
GGTTTCGGATTTGTCAACTTCTGCCATCCAGAGAATGCAAAGAAAGCTGTGGAGTCTCTCAATGGAAAACCACATGGAAC
GAAGAAGTTGTTTGTTGGAAGGGCTTTGAGGAAAGCTGAAAGGATGGAGATGCTGAAACAGAAGCACAAAGACAACTTTG
TTGCCAAGTTTAATGTTGGTTGGTTTAATCTGTACGTGAAGAACTTGAGTGAAGCAATCAACGAAACAAGGCTGCGAGAG
ATATTTGGAAGCTATGGGAAGATAGTCTCAGCAAAAGTGATGCGTGATGAAAATGGCAAGAGTAAAGGATTCGGCTTTGT
GGCTTTCTCTACCCTTGACGAGTCCAAACATGCTAAAAGAGAGCTCCACGGATTTATAGTGGATGGACAGTCACTTGTTG
TTCGAGTTGCTGAACGCAAGGAGGATCGCTTCAAGAGGATGCAGCAATATCATCCAGTACAATCACGCCACTACATGCAA
GCTGCTCCTGTCCCTTCAGCAGCTCAGCCGGTCCCGCCATCTATGGAGTACAAGCAATATTATGGAGTGCAGCCGCCACG
CAATTACACGCAAGCTCTTCCTGTGCCTTCACCAGCTCAGCCAGTCCCACCACCGTCTATGAGCAGCAGCCCATATGGTT
ACTTGCAGCCATTCCATATTGGAGCATACTACTACCCTATGGCCACTCAGGTACCACAGATGTCGGGTCACCAAAACATG
ACTACCTACGTTCCCGCTGGCCAAGCTCATCTAAAGGAGAAAAGATCAGTTCAACTAGTCTACAAACGCCCGGGTTACAC
CACCTTTGTCAAGAGTGGTGCTAAACAGAAACTGGTCTTTAAGGGGCAAGGTGACAAAACTTTAGAGGCAGGCACTTGCT
CCACCAAAGGGAAGACATCTGCTGAAAAACGTAAAGAAGTATCATCGCATTTGATGGCAATGTTGACACCAAACAGGAAT
GCTGCAGAGAATTTAGCAACACTTGAAGTTGCTTAG