Details for Chinese cabbage Locus Brara.E02505

Position : A05 ( 5`- 22304526 .. 22308007 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02505

Protein [Map View]
MYRTAALRAKALTGCLSRSFRASRYASTTAAAAAAAAATASPVFSGSSLPSLSIPLDGVSLPPSLPDNVGPSKLQTTTLP
NGLKIASEMSPNPAASVGLYVDCGSIYETPYSRGATHLLERMAFMSTLNRSHVRLVREIESMGASTSASASREQMGYTID
ALKTYVPQMVEVLVDSVRNPAFVDWEVNEELQKMKVEIGELAKNPMGYLLEAVHSAGYSGAMANPLYAPESAISGLTGDV
LEKFVSENYTAPRMVLAASGVEHEELLKVVEPLLSDLPNVARPVEPKSEYVGGDFRQHTGDEATHFALSFGVPGWDKEKE
AVMATVLQMLMGGGGSFSAGGPGKGMHSWLYLRVLNQYQEFQSCTAFTSIFNNSGLFGIYGCTSPEYAAKGIELVADEMK
AVAEGKVNQKHLDRAKAATKSAILMNLESRMIVAEDIGRQILTYGERKPVDAFLKTVDQLTLKDIADFTSKIIAKPLTMG
SLGAVLNVPSYDSVSSRFS*

DNA
ATGTACCGCACGGCAGCTTTACGAGCCAAGGCACTTACGGGCTGTCTTAGCCGCAGTTTCAGGGCATCACGCTATGCAAG
CACCACTGCTGCTGCTGCTGCTGCTGCTGCTGCTACGGCTTCACCAGTTTTCTCCGGTAGCTCGCTTCCTTCGTTGAGCA
TTCCCTTGGACGGTGTCTCTCTTCCACCATCACTCCCTGACAATGTCGGGCCTAGCAAGCTTCAGACCACTACTCTTCCT
AATGGTCTCAAAATAGCCTCTGAGATGTCTCCGAATCCAGCAGCTTCCGTTGGTTTATACGTTGACTGTGGCTCTATCTA
CGAGACACCTTATTCCCGTGGAGCGACGCACTTGCTTGAGAGGATGGCTTTCATGAGTACGTTGAACAGAAGCCATGTTC
GTCTTGTGAGGGAGATAGAGTCTATGGGAGCTAGTACTTCAGCTTCTGCATCTAGAGAGCAGATGGGTTACACCATCGAT
GCTCTGAAAACTTATGTTCCTCAAATGGTGGAAGTGCTTGTCGACAGTGTGAGGAACCCTGCTTTCGTGGATTGGGAAGT
CAACGAAGAGCTCCAGAAAATGAAAGTGGAGATAGGAGAACTTGCAAAGAACCCTATGGGTTATCTCTTGGAGGCGGTTC
ATTCAGCTGGTTACTCTGGCGCAATGGCGAATCCTTTGTATGCACCTGAGTCTGCAATTAGTGGATTAACCGGAGACGTC
TTGGAGAAGTTTGTTTCCGAGAACTACACTGCTCCACGAATGGTATTAGCAGCTAGTGGAGTAGAACATGAGGAGCTTTT
AAAAGTAGTTGAGCCCTTACTCTCTGACCTTCCTAATGTGGCTCGACCAGTGGAGCCTAAGTCTGAATATGTTGGTGGAG
ATTTCCGTCAACATACTGGTGACGAGGCTACACACTTTGCACTTTCTTTTGGAGTGCCAGGTTGGGATAAGGAGAAGGAA
GCTGTTATGGCCACTGTTCTTCAGATGCTTATGGGAGGAGGAGGCTCATTCTCTGCGGGAGGTCCTGGAAAGGGAATGCA
CTCTTGGCTCTACCTCCGCGTTTTGAACCAATACCAGGAGTTTCAATCATGCACTGCCTTCACTAGCATCTTTAACAACT
CTGGATTGTTTGGAATCTATGGCTGCACGAGTCCTGAGTATGCTGCAAAGGGAATTGAATTAGTAGCTGATGAAATGAAA
GCTGTCGCTGAAGGAAAAGTTAACCAGAAACATCTTGATCGAGCCAAGGCTGCTACTAAATCTGCAATTCTAATGAATCT
TGAATCTAGGATGATTGTAGCAGAAGACATTGGTAGACAGATACTTACATACGGGGAGAGGAAGCCAGTGGATGCATTCT
TAAAGACAGTGGACCAACTCACCTTAAAGGACATTGCAGATTTCACCAGCAAGATTATTGCAAAACCTTTGACGATGGGA
TCTTTAGGAGCAGTGTTGAATGTTCCAAGCTACGACTCCGTAAGCAGTAGATTTTCTTGA