Details for Chinese cabbage Locus Brara.E02504

Position : A05 ( 5`- 22301358 .. 22303194 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02504

Protein [Map View]
MGRAVRWFKGIFGMKKSKEKEYRVSGDGRGEAGESLIHRKVLQADNVWLRTYLAETDKEQNKHAIAVAAATAAAADAAVA
AAQAAVAVVRLTSNAKTGGHSGGNVVYGTTMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLYS
MQALIRAQTSVRSQRINRNNMLLPRHSLERFDDSRSEIHSKRMSISVEKHINNNTYDETSPKIVEIDTYKTKSRSRRMNV
AVSEFGDEDFEWSFRGEKCKFPTAQNTPRFSSSAAMNNNYYYTPPSPAKSVCRDACYKPSYPGLMTPSYMANTQSFRAKA
RSHSAPRQRPDRKRLSLDEIMAARSSVSGVRMVQPQPQLLQQQQEKRSSCNYDRQFPQEPVGFRFYN*

DNA
ATGGGTAGAGCAGTGAGATGGTTTAAGGGAATCTTCGGTATGAAGAAGAGCAAAGAGAAAGAGTACCGAGTTTCCGGCGA
CGGAAGAGGAGAAGCCGGTGAGTCTCTCATCCACCGGAAAGTTCTCCAAGCAGACAACGTCTGGCTCAGAACATACTTGG
CGGAAACAGACAAAGAACAAAACAAACACGCCATTGCGGTTGCTGCCGCCACTGCCGCAGCCGCAGACGCAGCAGTTGCA
GCGGCTCAAGCTGCCGTTGCGGTGGTCAGGCTAACAAGTAACGCGAAAACCGGAGGACATTCCGGTGGCAACGTAGTTTA
CGGGACCACAATGGAGCGGTGGGCCGCGGTGAAGATTCAAAGTGTCTTCAAGGGCTATTTGGCGAGGAAAGCGTTAAGAG
CGTTGAAAGGTCTAGTGAAGCTACAAGCTCTAGTGAGAGGATACTTAGTTCGCAAACGCGCAGCCGAAACGCTTTATAGC
ATGCAAGCTCTCATCAGAGCACAAACGAGCGTTCGGTCTCAACGCATAAACCGTAACAACATGTTGCTCCCTCGACATTC
TCTTGAGAGGTTTGATGATTCAAGAAGCGAGATCCATAGCAAGAGAATGTCAATCTCTGTGGAGAAACATATCAACAACA
ACACTTATGATGAGACCAGTCCCAAGATTGTTGAGATTGACACTTACAAGACTAAGTCAAGATCGAGGAGAATGAATGTT
GCTGTATCTGAATTTGGAGATGAAGATTTCGAATGGAGTTTTCGTGGAGAGAAATGTAAATTTCCCACGGCTCAAAACAC
CCCAAGATTCTCTTCATCGGCGGCAATGAATAATAATTATTACTACACACCGCCTTCGCCGGCAAAAAGCGTTTGCAGAG
ACGCTTGTTATAAGCCGAGTTATCCTGGTTTGATGACACCTAGCTATATGGCTAATACGCAGTCGTTTAGAGCCAAGGCG
CGTTCGCATAGTGCGCCGAGACAGCGTCCTGATAGGAAGAGGTTGTCGCTTGATGAGATTATGGCGGCTAGGAGTAGCGT
TAGCGGCGTGAGGATGGTCCAACCGCAACCGCAGTTACTGCAACAGCAACAAGAGAAACGTTCTTCTTGTAATTATGATC
GTCAGTTTCCACAAGAACCGGTTGGTTTTAGATTCTATAATTAG