Details for Chinese cabbage Locus Brara.E02500

Position : A05 ( 5`- 22274007 .. 22276930 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02500

Protein [Map View]
MQQETLSDPYGEIEISFGYQCNNNNNNNNNNKKTIGIPEDAIVPDSRGVLAGFRLQKTSSFSCLSGAALSGNPTLANTNI
CNGVIGSEILPSLDSPKSFRKVPSSPALSKLDILSPSLHGSMASLSCSPSPPEPESCFLTSMSSPSSSLNEGFVLSAMEV
QVAGGAAGEDRVQAVCSEENGWLFCAIYDGFNGRDAADFLACTLYESIVFHLQLLDHQMKTHQDVDDGGVSVIVDSSSSD
LFRQGVLDCLNRALLQAENDFLRMVEQEMEERPDLVSVGSCVLVTLLVGKDLYIMNLGDSRAVLATYNGNKKLQAVQLTE
DHTVDNEIEEARLLSEHLDDPKIVIGGKIKGKLKVTRALGVGYLKKEKLNDALMGILRVRNLLSPPYVSVEPSMRVHKIT
ESDHFVIVASDGLFDFFSNEEAIELVHGFIASNPCGDPAKFLLERLVAKAAARVGFTLEELLNVPAGRKRRYHDDVTVMV
ITLGTDQRTSKASTFV*

DNA
ATGCAGCAAGAGACGTTAAGTGATCCTTATGGAGAGATTGAGATAAGCTTTGGCTATCAATGCAATAACAACAACAATAA
CAACAATAATAATAAGAAGACGATAGGAATCCCTGAAGATGCTATTGTTCCTGATAGCCGCGGCGTTCTTGCTGGCTTTA
GGCTTCAAAAGACAAGCAGCTTCTCTTGTCTCTCAGGTGCTGCTTTAAGCGGCAACCCTACACTAGCCAACACCAACATC
TGCAACGGAGTCATCGGCTCCGAGATTCTACCCTCTCTAGACTCTCCCAAATCCTTCAGGAAAGTTCCCTCTTCCCCCGC
GCTTTCCAAGCTCGACATACTCTCTCCTTCTCTCCACGGAAGCATGGCGAGTCTCAGCTGCAGCCCGAGTCCTCCAGAGC
CGGAGTCTTGCTTCTTGACCTCCATGAGTTCTCCTTCCTCTTCTCTGAACGAAGGGTTTGTTCTCTCAGCTATGGAAGTT
CAAGTCGCGGGTGGTGCTGCTGGTGAAGATAGAGTTCAGGCCGTGTGCTCTGAGGAGAACGGTTGGCTCTTCTGCGCTAT
CTACGACGGATTCAACGGAAGAGATGCTGCTGATTTCTTGGCTTGTACTTTGTACGAGTCCATTGTTTTCCATCTCCAGC
TGCTTGATCACCAGATGAAGACGCATCAAGATGTTGATGATGGAGGCGTCAGTGTAATAGTAGACTCTTCTTCCTCTGAT
TTGTTCAGACAAGGAGTGTTGGATTGCTTGAACCGCGCGCTTCTCCAGGCGGAAAACGATTTCTTGAGGATGGTTGAGCA
AGAGATGGAGGAGAGACCGGACTTGGTGTCTGTTGGTTCTTGTGTTCTGGTCACTCTCCTTGTCGGGAAGGATCTTTACA
TCATGAATCTAGGGGATAGCAGAGCTGTGCTGGCGACGTACAACGGTAACAAGAAGCTGCAAGCTGTTCAGCTCACGGAG
GATCACACTGTTGATAACGAAATAGAAGAAGCTAGGCTATTGAGTGAGCATCTTGATGATCCTAAGATCGTTATTGGTGG
GAAGATCAAAGGGAAACTTAAAGTGACACGTGCTCTAGGAGTTGGTTACTTGAAGAAGGAGAAACTGAACGATGCACTGA
TGGGGATTCTTCGAGTTCGTAACCTTTTGAGTCCGCCTTACGTTTCGGTGGAACCATCGATGAGAGTTCATAAGATAACG
GAGTCAGATCACTTTGTTATAGTTGCAAGCGATGGTTTGTTTGATTTCTTCAGCAACGAGGAAGCGATAGAGCTTGTTCA
TGGCTTCATTGCTAGTAATCCTTGTGGTGATCCAGCAAAGTTTCTACTTGAACGTCTTGTAGCTAAAGCTGCTGCTCGTG
TTGGATTCACGTTGGAAGAGTTGCTGAATGTTCCGGCTGGTCGGAAAAGGAGATATCATGACGATGTGACTGTGATGGTA
ATCACTCTCGGTACTGATCAACGCACCTCAAAGGCTTCTACGTTCGTGTGA