Details for Chinese cabbage Locus Brara.E02499

Position : A05 ( 5`- 22268616 .. 22271205 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02499

Protein [Map View]
MDSPPPTKLEYHEDMFKLQSQATFLSLFKAEDGRIALILDSTVFHPQGGGQPSDTGLIEFAGSDFKFSVQDVRSKDGIVL
HYGVFQGSAPGDIEKGEEVHLLVDESRRKLNSRLHSAGHLLDLCMQKVGLGHLEPAKGYHFPDGPFVEYKGVVPQAELLV
KQKELEAEANELISKGGKVYADILPYEEASLLCGGTLPDYIPKGSTPRVLRLGENPGCPCGGTHVSDISDIISMKITQMR
TKKGMTKVFYTIAS*

DNA
ATGGATTCTCCTCCTCCGACGAAGCTTGAATATCATGAGGACATGTTTAAACTTCAATCCCAAGCCACGTTCCTCTCCTT
ATTCAAGGCGGAGGATGGACGTATAGCTCTTATATTGGACTCCACCGTGTTTCATCCGCAAGGTGGAGGCCAGCCGTCGG
ACACCGGTTTAATCGAATTCGCCGGTTCGGATTTCAAGTTCTCGGTTCAAGATGTTCGATCCAAAGATGGAATCGTTCTC
CATTACGGAGTTTTCCAAGGTTCAGCTCCTGGAGATATTGAAAAGGGGGAAGAAGTTCACTTGCTTGTTGATGAATCAAG
GCGTAAACTCAATTCCAGGTTGCACTCAGCTGGGCACTTGCTGGATTTGTGTATGCAGAAAGTTGGGTTGGGACATTTGG
AGCCTGCGAAAGGGTATCATTTCCCTGACGGTCCTTTTGTGGAATACAAAGGAGTCGTTCCACAGGCTGAACTGCTGGTG
AAGCAGAAAGAGTTGGAGGCAGAGGCTAATGAACTAATATCCAAAGGAGGAAAGGTTTATGCTGATATATTACCCTATGA
AGAGGCATCCCTGCTCTGTGGTGGCACTCTTCCTGATTATATTCCCAAGGGCAGCACTCCCCGAGTCTTAAGATTAGGTG
AAAACCCTGGGTGTCCGTGTGGTGGCACCCATGTCTCCGATATATCTGATATCATAAGCATGAAGATCACACAGATGAGA
ACAAAGAAAGGAATGACAAAAGTTTTCTACACCATTGCATCTTAA