Details for Chinese cabbage Locus Brara.E02491

Position : A05 ( 5`- 22234799 .. 22236183 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02491

Protein [Map View]
MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWTTVGAVDVNIGANPSAEEGGEDEGVDDTTQKVVDIVDTFRLQEQP
TYDKKGFIAYIKKYIKLLTPKLNEEDQAAFKKGIEGATKFLLPKLNDFQFFVGEGMHDDSTLVFAYYKEGATNPTFLYFG
HGLKEVKC*

DNA
ATGTTGGTGTACCAAGATCTTCTCACCGGTGATGAGCTTTTGTCTGACTCTTTCCCTTACAAGGAGATTGAGAATGGTAT
TCTTTGGGAAGTTGAAGGAAAGTGGACTACCGTTGGAGCTGTGGATGTGAACATTGGTGCCAATCCCTCTGCTGAAGAAG
GTGGTGAGGACGAAGGTGTTGATGACACGACTCAAAAGGTTGTTGACATTGTGGACACCTTCAGACTTCAGGAGCAGCCG
ACTTATGATAAGAAGGGCTTCATCGCCTATATTAAAAAGTACATCAAGCTTTTAACACCAAAGCTCAACGAGGAAGATCA
AGCAGCCTTCAAGAAGGGTATTGAGGGAGCTACCAAGTTCTTGCTCCCCAAGCTCAATGACTTCCAATTCTTTGTTGGGG
AGGGGATGCATGATGACAGCACTTTGGTATTTGCTTACTACAAGGAGGGTGCAACTAACCCAACATTTTTGTACTTTGGA
CATGGTTTGAAGGAGGTCAAGTGCTGA