Details for Chinese cabbage Locus Brara.E02488

Position : A05 ( 5`- 22214833 .. 22218541 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02488

Protein [Map View]
MTSHGGERIHTVQPERDLVANWEVDLSEKLEEYLLKICTGEITGNEEEDGKIPVNFAEAALLLQGSVQVYSKKVEYLYNL
VLRTLEFLSKQRDQEESNGTSNEAEASSSRQVDEEENDLFWNVDDIPVDAKNSLDNSVGGDSCPNQFVKPPANLVVLEGD
CLDTSGDGGELESYLLATTHLYRDFILLDPCDAVAVNDFLGDDNYAGKRRNSARRGSSARKSFHSPVGRSGGSARRSSLG
KNQGTSFNHTPVNGNGPDAQNYDQESQPPPDFGDNDHGFDMDNDHGGTMDLSDTDADEDDPWKPLNPYEPGKLKVKPFKK
VKTLRKFGASLTKDHMTTMFPLARPNGPISTELSGIWEKRRPSSNNEREPEDIPYYEKLRALLVNGGNQPTDANGNQKEG
FKDNNDEANYGDFHDFGEHGGDDHEHAFMDEDGPDMNDDGAADFPNHDGFGNDDSHCQESLEDLCRSHLDALLANIAKSE
KQTDLAARVSTWKQKIELNLEEQELHPPFDIQEYGERIVSKLTVEESRDVETFTDLMKDQEKHDVARAFSALLQLVNNGD
VELEKPGNSVGEPVCYTAVNPFSVRLLSDRNRKAEKNAMHLPRKREKSPTAKGKSPESPPSKKANNTCSVSSKETRKVSL
KISKINNVGTKCTRKSKKR*

DNA
ATGACGAGTCACGGCGGGGAGAGGATTCACACGGTACAGCCGGAGAGAGATTTGGTGGCGAATTGGGAAGTTGATTTATC
GGAGAAGCTAGAAGAGTACCTCCTCAAGATATGTACCGGAGAAATCACCGGAAACGAAGAAGAAGATGGGAAGATTCCTG
TTAATTTCGCCGAAGCTGCTTTGTTGCTTCAGGGTTCGGTTCAGGTTTACAGCAAGAAAGTTGAGTACTTGTACAATTTG
GTCTTACGTACTTTGGAGTTTCTATCCAAGCAAAGAGACCAGGAAGAGTCCAACGGTACATCAAACGAGGCTGAGGCAAG
CTCCTCTCGTCAGGTTGATGAAGAAGAAAATGATCTCTTCTGGAACGTGGATGACATCCCAGTTGATGCAAAGAATAGCT
TGGACAACTCGGTTGGCGGAGATTCATGTCCAAATCAGTTTGTTAAGCCTCCAGCAAATCTTGTTGTTCTTGAAGGTGAC
TGCTTGGATACTAGTGGTGACGGAGGAGAGCTGGAATCTTATCTGTTAGCAACTACACATCTCTACCGGGATTTTATTCT
ATTAGACCCATGTGATGCTGTAGCGGTAAATGATTTTTTAGGTGATGATAACTATGCTGGTAAAAGAAGGAACAGTGCTC
GCAGAGGCAGCTCAGCTCGTAAAAGTTTTCACTCACCAGTAGGACGTTCTGGAGGAAGTGCTCGTAGATCATCCCTAGGA
AAGAATCAGGGCACCAGTTTCAACCATACACCAGTAAATGGGAATGGTCCCGATGCTCAAAACTATGACCAAGAGTCTCA
ACCTCCTCCTGACTTTGGAGACAATGATCATGGCTTTGACATGGATAATGACCATGGAGGAACCATGGATTTGAGTGATA
CAGATGCTGATGAAGATGATCCGTGGAAGCCATTGAATCCCTATGAGCCAGGGAAGTTGAAAGTGAAGCCTTTTAAAAAA
GTGAAAACTTTAAGAAAGTTTGGAGCGAGCCTTACCAAGGACCATATGACTACCATGTTTCCTCTGGCTAGACCCAACGG
TCCCATCAGTACAGAGCTCAGCGGAATTTGGGAGAAGCGCCGTCCTTCTAGTAACAATGAGAGAGAACCAGAAGACATTC
CTTATTACGAAAAGCTTCGAGCATTGCTTGTGAATGGAGGAAACCAACCTACTGATGCTAACGGCAATCAGAAGGAGGGC
TTTAAGGATAACAATGATGAAGCTAATTATGGCGACTTCCATGATTTTGGAGAGCATGGTGGTGATGATCATGAACATGC
GTTCATGGATGAAGATGGTCCAGACATGAATGATGATGGAGCTGCAGATTTCCCCAACCACGATGGGTTTGGAAACGACG
ACTCGCATTGTCAAGAAAGCTTGGAAGATCTTTGTCGCTCACACCTGGATGCTCTTCTTGCTAACATAGCTAAAAGTGAG
AAGCAGACAGATCTAGCTGCTCGAGTTTCAACTTGGAAACAGAAAATCGAGCTAAACCTAGAAGAACAAGAGCTGCACCC
TCCTTTTGACATTCAAGAATATGGAGAAAGGATTGTCAGCAAACTGACTGTTGAAGAGAGCCGAGACGTTGAGACCTTTA
CGGATCTCATGAAAGACCAAGAAAAACACGATGTAGCCCGGGCTTTCTCCGCGCTTCTCCAGTTGGTGAACAATGGAGAC
GTTGAGCTGGAGAAACCTGGGAACTCGGTAGGCGAACCAGTGTGTTATACGGCGGTTAATCCTTTCAGCGTTCGGTTACT
CAGTGATCGTAACAGAAAGGCTGAGAAAAATGCAATGCATTTACCTCGGAAACGAGAAAAATCCCCCACAGCCAAAGGCA
AATCTCCAGAGTCACCACCATCAAAGAAGGCAAACAACACATGTTCTGTCTCAAGCAAAGAGACTAGGAAAGTGTCCTTA
AAGATATCAAAGATCAACAATGTCGGCACTAAGTGCACACGGAAGAGCAAGAAGAGATGA