Details for Chinese cabbage Locus Brara.E02487

Position : A05 ( 5`- 22212430 .. 22213623 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02487

Protein [Map View]
MCGGAIISDFVPILTKAKGRKLTAEELWSELDASAGDYLWGFHPTSKLQSTNQEEVALKDEAVVNKREPATEKRRRKNVY
RGIRKRPWGKWASEIRDPRKGTRVWLGTFNTAEEAAMAYDVAAKRIRGDKAKLNFPDLIPPPATPALTSSPPSDDQPPAK
KLCLLSQSELTRPSFPVECIGFGNGDQFQNHSYGFDLDYDLKQQISSLESFLELDGGTTVEQPSQLDESVDMWMIDDVIS
SYA*

DNA
ATGTGTGGCGGTGCTATCATTTCCGATTTTGTTCCTATCCTCACCAAGGCCAAGGGTAGGAAACTCACGGCGGAGGAACT
CTGGTCTGAGCTCGATGCTTCCGCCGGCGACTATTTATGGGGTTTCCATCCCACCTCCAAGCTTCAGTCCACCAACCAAG
AAGAAGTGGCGTTGAAAGATGAGGCGGTGGTGAATAAGAGGGAGCCTGCGACGGAGAAACGGAGGAGGAAGAACGTTTAC
AGAGGGATACGCAAGCGTCCCTGGGGAAAATGGGCGTCAGAGATACGAGATCCGCGAAAAGGCACCAGAGTCTGGCTCGG
GACGTTCAACACGGCGGAGGAAGCCGCCATGGCTTATGACGTAGCGGCTAAGCGTATCCGCGGCGACAAAGCCAAGCTCA
ACTTCCCAGATCTTATTCCTCCTCCTGCCACTCCGGCTCTGACGTCATCTCCACCATCAGACGATCAGCCTCCGGCGAAG
AAGCTCTGCTTACTCTCTCAGAGCGAGTTAACTCGGCCGAGTTTCCCGGTCGAGTGCATTGGGTTCGGGAACGGTGACCA
GTTTCAGAACCATAGTTACGGGTTTGACCTTGATTACGATCTCAAACAGCAGATATCGAGCTTGGAGTCTTTCCTTGAGC
TTGACGGTGGTACCACGGTGGAGCAGCCGAGTCAGCTCGACGAGTCAGTGGATATGTGGATGATTGATGATGTCATCTCA
TCGTATGCATAA