Details for Chinese cabbage Locus Brara.E02483

Position : A05 ( 5`- 22182446 .. 22186521 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02483

Protein [Map View]
MSSKGLKPTKRKDNESFEKPDALKSKKPKLAPSNNTIQNQKPGGQEHGKPKAFGNTDKSVVTLSKKERRVQAKELTEARK
KRRKPHYTLEQELATLWEKMRRRDIGKEDRLKLISEAIQKMKGKMHEIAGSHVSSRVLQTCLKYCSQDEKEVVFKELHPH
FLSLASNTYAVHVLQKMLDGASKQQLSACISSLRGHVASLLRHMVGSVVVDHAYHLGNAAQKQELLGELYSTELQLFKDL
NSTSEKRVVDIIAKLGLQKGSVIRHMTAIVQPILEKGIVDHNITHKLLIEYMTVADKTSAAFVIQQLSGPLLIRMVHTRD
GSRLAMLCVKHGSAKERKKLIKAMKTEKDSHVGSIASDQYGSMVLACIFSIVDDTKLVTKIIVRELEANLKDLVMGKNGR
RPLLQLLHPNSSRYFSRDDLASLELSVPSLCLMDKSETKDSDGKESAEEEKDEEEDTVTEQSGLEENVTVAGSKKDPLLR
RQELLVKSGLAERLIDVCVENAEEFLKSNFAKEVMYEVAVGGCDGILLPTLSENLRELYQAIASVAAEPKPEESEKSSQH
ILEDFHSSRTIRRLVLDSPTFASILFKKALSGKCRSWAQGHCSRILSAFVETQDVQVREMAKEELQVLVDEGALKITGTK
KPE*

DNA
ATGTCTTCCAAGGGATTGAAACCGACCAAGAGGAAAGATAACGAAAGCTTTGAGAAACCCGATGCTCTCAAATCGAAGAA
GCCGAAGCTAGCTCCGTCTAACAATACGATTCAGAACCAAAAGCCTGGAGGACAAGAACATGGTAAACCGAAAGCTTTTG
GAAACACCGACAAGAGTGTTGTTACCCTCTCCAAGAAGGAGCGTCGCGTACAAGCTAAGGAGCTGACAGAAGCAAGGAAG
AAGAGGAGGAAGCCTCATTACACTCTCGAGCAAGAGCTTGCTACTCTATGGGAGAAGATGAGGCGCCGTGATATTGGCAA
GGAGGACCGTTTAAAGCTGATATCTGAAGCTATACAAAAGATGAAGGGGAAAATGCACGAGATTGCAGGTTCTCATGTCT
CTTCCCGTGTTCTCCAGACTTGTTTGAAGTATTGCTCGCAAGATGAGAAGGAAGTTGTTTTCAAAGAGCTTCATCCGCAT
TTTCTTAGCCTGGCTTCTAATACATACGCTGTTCATGTGTTGCAGAAGATGTTGGATGGAGCATCTAAGCAGCAGCTTTC
AGCCTGTATATCCAGTCTCCGCGGACACGTGGCTTCTCTCCTCCGTCACATGGTCGGATCTGTTGTTGTGGACCATGCAT
ACCATCTGGGGAATGCAGCACAGAAACAAGAACTCCTTGGAGAGTTGTACTCTACAGAGCTTCAGTTATTCAAAGACTTG
AACTCAACTTCCGAGAAAAGGGTGGTGGACATTATCGCTAAGCTAGGACTACAGAAAGGGTCTGTTATCCGCCACATGAC
TGCCATTGTTCAACCAATTCTTGAGAAGGGAATTGTCGACCACAACATCACACACAAATTGCTGATTGAGTACATGACAG
TAGCTGATAAGACTTCTGCTGCATTTGTGATTCAGCAACTGTCAGGTCCGCTTCTTATACGTATGGTTCACACCCGTGAT
GGTTCTAGGCTTGCTATGCTTTGTGTCAAACATGGAAGTGCTAAGGAGAGAAAGAAGCTTATCAAAGCAATGAAAACAGA
GAAAGACAGCCATGTTGGAAGTATTGCTTCTGATCAGTATGGAAGTATGGTGCTTGCATGTATTTTCTCCATAGTTGATG
ACACAAAGCTAGTAACCAAGATTATTGTTCGTGAGCTGGAGGCCAACTTAAAGGATCTTGTTATGGGAAAGAATGGTAGG
AGACCACTATTGCAGTTACTTCATCCAAATTCCTCACGTTATTTCAGTCGTGATGATTTGGCCTCTCTTGAACTGTCTGT
TCCATCACTGTGCTTAATGGATAAGTCTGAGACAAAGGACTCAGATGGCAAAGAATCTGCTGAGGAGGAGAAAGACGAGG
AAGAAGATACTGTAACTGAACAGAGCGGTCTTGAAGAAAATGTCACAGTTGCAGGCAGTAAAAAAGATCCCCTTTTGAGA
AGGCAGGAGTTGCTAGTCAAGAGTGGCCTTGCTGAGCGGCTTATTGATGTCTGTGTGGAGAACGCTGAGGAATTCCTGAA
GTCTAACTTTGCCAAAGAAGTCATGTATGAGGTGGCCGTGGGAGGCTGTGATGGTATTCTTTTGCCAACTCTGAGCGAGA
ATCTGCGTGAGCTGTACCAAGCCATTGCCTCTGTAGCAGCAGAGCCGAAACCCGAAGAATCAGAAAAGAGTTCACAGCAC
ATCCTGGAAGACTTTCACTCCAGCCGAACAATTAGAAGGCTGGTCTTGGACAGCCCTACTTTTGCTTCCATTCTTTTTAA
GAAGGCCTTGTCTGGAAAATGTCGTTCATGGGCTCAAGGACACTGTTCAAGGATATTATCTGCTTTCGTAGAGACTCAAG
ATGTTCAAGTGCGTGAGATGGCTAAGGAAGAGCTGCAAGTGTTGGTGGACGAAGGTGCTCTAAAGATCACAGGAACCAAG
AAGCCCGAATGA