Details for Chinese cabbage Locus Brara.E02479

Position : A05 ( 5`- 22141075 .. 22141882 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02479

Protein [Map View]
MSDGSVETKTKLDSSGESSDVDNENCISSGGGSSGEAKRTCVDCGTFRTPLWRGGPAGPKSLCNACGIKSRKKRQAALGI
KPEKKIRKSIIITSDTSDLSLEDDDDHSSSSKGIMSRFLDLGFKVPVMKRSPVEKKKRLWSKLGEEERAAAVLLMALSCA
SVYA*

DNA
ATGTCTGACGGATCAGTAGAAACGAAAACAAAGCTTGATTCTTCCGGAGAGTCATCGGACGTCGATAACGAGAACTGCAT
TAGCAGTGGAGGTGGAAGTAGCGGCGAAGCGAAGCGGACTTGCGTTGATTGCGGAACATTCCGAACTCCCCTTTGGCGCG
GTGGCCCTGCTGGACCTAAGTCGTTGTGCAATGCGTGTGGGATCAAGAGCAGGAAGAAGAGGCAAGCTGCTCTCGGGATC
AAACCAGAGAAGAAAATCAGAAAAAGCATCATCATCACCAGTGATACTAGTGATCTAAGCCTTGAAGATGATGATGATCA
CAGCAGCAGCAGCAAAGGAATAATGAGTAGATTTTTGGATTTAGGGTTTAAAGTTCCGGTGATGAAGAGATCACCGGTTG
AAAAGAAGAAGAGGCTGTGGAGTAAACTCGGCGAGGAAGAGAGAGCCGCCGCCGTGCTTCTCATGGCTCTCTCTTGTGCC
TCCGTGTATGCTTAA