Details for Chinese cabbage Locus Brara.E02475

Position : A05 ( 5`- 22114767 .. 22115999 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E02475

Protein [Map View]
MAESGGRRIGVAVDFSECSKKALNWAIDNVVRDGDYLILITVAPNMNYEEGEMQLWETVGSPLIPLSEVSEASVMKKYGV
KPDAETLDIANTAARQKSITVVMKIYWGDPREKICEAVEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK
AHH*

DNA
ATGGCGGAGAGTGGTGGACGGAGAATTGGAGTGGCGGTGGACTTCTCGGAGTGCAGCAAGAAGGCTTTGAACTGGGCGAT
CGACAACGTCGTCCGCGACGGAGATTATCTAATCCTCATAACCGTGGCTCCCAATATGAATTACGAGGAAGGCGAGATGC
AGCTCTGGGAGACCGTTGGATCACCGTTGATTCCATTGAGTGAGGTCTCTGAAGCTTCCGTGATGAAGAAGTATGGAGTG
AAGCCAGATGCTGAAACCCTTGACATTGCCAACACTGCCGCTAGGCAAAAATCGATTACAGTAGTGATGAAGATATATTG
GGGAGATCCTCGTGAGAAGATATGTGAGGCTGTTGAACATATCCCTCTCTCAAGTCTTGTCATCGGTAACCGTGGCCTTG
GTGGCCTTAAGAGGATGATAATGGGAAGTGTTAGCAACCATGTTGTCAACAACGTTGCATGCCCTGTTACCGTCGTCAAG
GCTCACCACTGA